DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4462 and CG4630

Sequence 1:NP_650849.1 Gene:CG4462 FlyBaseID:FBgn0038752 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_001260948.1 Gene:CG4630 FlyBaseID:FBgn0033809 Length:582 Species:Drosophila melanogaster

Alignment Length:613 Identity:133/614 (22%)
Similarity:230/614 (37%) Gaps:168/614 (27%)


  Fly    34 PPAPAGS------DVIADVVGDFGIWQLRTILIIFLCKIPAAWFMACIIFTG---------PE-- 81
            |.|.|.|      |::.: :|:||.:|.|..|:|.|..:.||......:||.         ||  
  Fly     4 PAAGAASAVLDFDDILVE-IGEFGRFQRRNYLLICLPVLFAAANSLSYVFTAGSPTYRCYVPECD 67

  Fly    82 --------------LYPGS-------------EFTCDTSYLTSSSNSSFSISDNQCYVLDESTGT 119
                          ..|||             .|..:..:|.|||:...:...:||:..:.:|.|
  Fly    68 KLVDAEYGANWVSIAVPGSWSKRGHFTPSTCERFVANGDHLESSSDPWSAWPLDQCFAENFTTET 132

  Fly   120 SSECEQFNYVSSFDSLIMQFNLVCLRDIF-VAWTQYWHLFGVLVGGVM--------GTKMMLGIS 175
             ..|.||.|.||..:::.|:.|.|..::: :|:....|..|::||..:        |.|.:.   
  Fly   133 -ERCNQFVYGSSERTIVQQWGLQCPENLWKLAFVGTIHFAGLVVGTALSGYLADRYGRKHIF--- 193

  Fly   176 PRSTYCVGAVAQILCGVVTGYARDFSLHCAFRCLSAVCCAIMFTAGQAIFADITAGMHRIGAIIL 240
               .:|:  |...|.||....:.|:.....|..|:||..:.::.....|..::.....|..:.|:
  Fly   194 ---LFCI--VFMALTGVAQALSWDYISFLFFALLNAVGTSGVYPLAFIIGVEMVGPRKREMSSIV 253

  Fly   241 YDTFWSIGVILLPGLSSFFNSWSLIYVGITFPTIMLILLLYWTPDSPRWLL-RHAADRFSIDNVE 304
            .:.|:::|..|| |||.|...|..:.:.::.|.::.:...:..|:|.|||| |:..::..:    
  Fly   254 LNYFYAVGEALL-GLSVFLPDWRQLQLALSVPPLICVAYFWLVPESVRWLLARNRREQAGV---- 313

  Fly   305 QILREGAAIN--DRSFKIPPDFRQQLEQLSERLKAQPPPAPWTE----------LWKGKR--AKT 355
             |:|..|.:|  |.|.::...|:||      .|.|:.......|          :|...:  |::
  Fly   314 -IIRRAAKVNRRDISVELMASFKQQ------ELDAETGQEDDVEGGLHVKKDDKIWLAVKEVARS 371

  Fly   356 HMVAAHLALAFFV-----INFMGMLLNIRSF-GRDYLVPNTIAMGFSEIIGCFLALHF------- 407
            |::....|:...:     |.:.|:.||..|. |..||  |...:...||.|..||..|       
  Fly   372 HILMGRYAILLLIWAVNAIVYYGLSLNATSLSGNKYL--NFALVCLVEIPGYSLAWLFLRRFGRR 434

  Fly   408 --------------------TLKHNKW-----------KWQCAGVFNILAGILGCMGWIFTNADS 441
                                ||....|           .|.||.                     
  Fly   435 VALSGSLLLCSITCVASGFVTLAQGDWIPCQTGVESRHSWSCAN--------------------- 478

  Fly   442 MDADLKVSLWMIIA--TIPKAAVSCAQSMILACMNELMPANKKQLFVFSVVTWARVWLLSAPFFN 504
                     |:::.  .:.|..::.:.::|.....|:||...:...|..:.|:||...:.|||..
  Fly   479 ---------WLVVTLFLVGKLGITSSFAVIYTFTAEMMPTVIRSGGVGVMSTFARFGAMLAPFVP 534

  Fly   505 VLRKIDTAMSLTSYCVFSILGGICTSLL 532
            :|......:.|..:...|::.|:.:.||
  Fly   535 LLASYYDPLPLLLFGTLSLVAGLLSLLL 562

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4462NP_650849.1 2A0119 <126..532 CDD:273328 99/476 (21%)
MFS 149..>284 CDD:119392 30/143 (21%)
CG4630NP_001260948.1 2A0119 23..573 CDD:273328 128/594 (22%)
MFS 158..533 CDD:119392 87/427 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C104152943
eggNOG 1 0.900 E1_KOG0255
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D704438at2759
OrthoFinder 1 1.000 FOG0000018
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24064
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.