DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP92B and Bnip2

DIOPT Version :10

Sequence 1:NP_650844.1 Gene:RhoGAP92B / 42371 FlyBaseID:FBgn0038747 Length:740 Species:Drosophila melanogaster
Sequence 2:NP_001361679.1 Gene:Bnip2 / 12175 MGIID:109327 Length:348 Species:Mus musculus


Alignment Length:120 Identity:26/120 - (21%)
Similarity:46/120 - (38%) Gaps:21/120 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   577 PVPMTRTQFFGLDNLPSPTADRKSTDSIGSFKLKPDVPQKPLL---------PKRPTVLGVGVPK 632
            |:|:........|.|.....||:.    ||.::..:..:|.|:         |...::....:.:
Mouse    16 PIPLPEDDSIEADTLDGTDPDRQP----GSLEVNGNKVRKKLMAPDISLTLDPGEDSLWSDDLDE 76

  Fly   633 ADGKSDDEGGTTPTQATIDNGNGSVRFKTEHFLDKLRQENGETNGTREVSSTTKE 687
            | |:.|.||..||::       .|..|:.|..|.|.:.......|:....:.|:|
Mouse    77 A-GEVDLEGLDTPSE-------NSDEFEWEDDLPKPKTTEVIRKGSITEYTATEE 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP92BNP_650844.1 BAR 27..257 CDD:472257
RhoGAP_nadrin 245..452 CDD:239851
PRK13855 495..>650 CDD:172376 18/81 (22%)
Bnip2NP_001361679.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47 8/34 (24%)
BNIP2 49..163 CDD:463609 18/83 (22%)
SEC14 147..295 CDD:214706
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.