DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ask1 and MAP3K6

DIOPT Version :8

Sequence 1:NP_477089.3 Gene:Ask1 / 42366 FlyBaseID:FBgn0014006 Length:1363 Species:Drosophila melanogaster
Sequence 2:NP_004663.3 Gene:MAP3K6 / 9064 HGNCID:6858 Length:1288 Species:Homo sapiens

Alignment Length:1382 Identity:489/1383 (35%)
Similarity:694/1383 (50%) Gaps:208/1383 (15%)


  Fly     1 MDVVCVMDTAVGDHLEDRQ----------CALEEIKQAVQ-SAGANFQRVQFERLDFGETNVLET 54
            :.||.|:.......||.|:          |..|...|..: ......:.:.|..|:.|:|..|:.
Human    45 LSVVYVLTREPQPGLEPREGTEAEPLPLRCLREACAQVPRPRPPPQLRSLPFGTLELGDTAALDA 109

  Fly    55 FYNADVAIIDLSILTQQRPLSYHYGVRESFGMKENILTYNDIDSKQTLSLK-------LSC-ANY 111
            ||||||.::::|....|..|.||.||||||.|..|:|..:..|.....:|:       ..| .:|
Human   110 FYNADVVVLEVSSSLVQPSLFYHLGVRESFSMTNNVLLCSQADLPDLQALREDVFQKNSDCVGSY 174

  Fly   112 LFLSYKRNAE----TNSCHLTSQPNSGNNSKEPNAEGRVPTLQWRLKRKLQDVEIQSKAHMREKF 172
            ..:.|...|.    .....|......|........|..:..|..||.|.|:.....|..:.||..
Human   175 TLIPYVVTATGRVLCGDAGLLRGLADGLVQAGVGTEALLTPLVGRLARLLEATPTDSCGYFRETI 239

  Fly   173 LSDMRTARDTYATNGAKLQSILHEMRKRLDDPHVLSGEVVHSFMCSLRDVQDYDAMVRLVNDLKN 237
            ..|:|.||:.:  :|.:|:..|..:::|||...:||.:::.:.:.|.||||||.|::.||..|:.
Human   240 RRDIRQARERF--SGPQLRQELARLQRRLDSVELLSPDIIMNLLLSYRDVQDYSAIIELVETLQA 302

  Fly   238 IPNTRKYVETGNMSFLYAFALNRRNRKGDREKALESSLKALEKKENHFPDMLCLCGRIYKDIFVE 302
            :| |....|..|:.|.|.||||||||.|||.|||...|..::.:.:..||:.|:|||||||:|..
Human   303 LP-TCDVAEQHNVCFHYTFALNRRNRPGDRAKALSVLLPLVQLEGSVAPDLYCMCGRIYKDMFFS 366

  Fly   303 SDYTDATSLAHAIKWYRQSFEVQPNEYAGINLATLLVIEGKEFTNTEELQHIGMTLNNLIGKKGS 367
            |.:.||.....|..|||::|:|:|:.::|||.|.||:..|:.|.:::||:.|||.|..|:.:||.
Human   367 SGFQDAGHREQAYHWYRKAFDVEPSLHSGINAAVLLIAAGQHFEDSKELRLIGMKLGCLLARKGC 431

  Fly   368 LSSLSEYWDVATFFEISVLANDYAKAIQAAECMFKLKPPNWYLKSTIGNISLIHRFRKKPEERQP 432
            :..:..||||..:....:||||..:.:.|||.::||..|.|||.|.:....|...||..||....
Human   432 VEKMQYYWDVGFYLGAQILANDPTQVVLAAEQLYKLNAPIWYLVSVMETFLLYQHFRPTPEPPGG 496

  Fly   433 PIEEQVFQFWMDFFLEATNTEEVKNSI----RFPILILEPQKIYMPSYV---------TINMDAD 484
            |....  .||:.|.|:  :.:..|.:.    :..:|:||..|:.:|:.:         |:.:...
Human   497 PPRRA--HFWLHFLLQ--SCQPFKTACAQGDQCLVLVLEMNKVLLPAKLEVRGTDPVSTVTLSLL 557

  Fly   485 EKSIQIVNICLAHAKNACKKIHDFLFVASKIKSVSLYKRDDRCAYLYVHHNSDDFQIYFPSTERR 549
            |...|.:.             ..:.|..:.|..||..|||:||.:||....:.|.|:.|||....
Human   558 EPETQDIP-------------SSWTFPVASICGVSASKRDERCCFLYALPPAQDVQLCFPSVGHC 609

  Fly   550 QKFYDMILEMTADQVVFVNLSNDDAN------------IEYEYDYDEQNRKMVLGKGTYGTVYAA 602
            |.|..:|...         ::|.|:.            :|::|:|.|...::||||||||.|||.
Human   610 QWFCGLIQAW---------VTNPDSTAPAEEAEGAGEMLEFDYEYTETGERLVLGKGTYGVVYAG 665

  Fly   603 RDKQTQVRIAIKEVPEKNSQDVQPLHEEIKLHSQLRHRNIVRYLGSCSENGFFKIFMEQVPGGSL 667
            ||:.|:|||||||:||::|:..|||||||.||.:|||:||||||||.|:.|:.|||||:||||||
Human   666 RDRHTRVRIAIKEIPERDSRFSQPLHEEIALHRRLRHKNIVRYLGSASQGGYLKIFMEEVPGGSL 730

  Fly   668 SDLLETKWGPLKDNESTMAFYSKQILEGLKYLHEQDIVHRDIKGDNVLVNTYSGVVKISDFGTSK 732
            |.||.:.||||||||||::||::|||:||.|||:..||||||||||||:||:||::|||||||||
Human   731 SSLLRSVWGPLKDNESTISFYTRQILQGLGYLHDNHIVHRDIKGDNVLINTFSGLLKISDFGTSK 795

  Fly   733 RLARINPMTETFTGTLQYMAPEVIDQGVRGYGPAADIWSFGCTNVEMATGKPPFIELGSAHAAMF 797
            |||.|.|.||||||||||||||:||||.||||.||||||.|||.:|||||:|||.||||..||||
Human   796 RLAGITPCTETFTGTLQYMAPEIIDQGPRGYGKAADIWSLGCTVIEMATGRPPFHELGSPQAAMF 860

  Fly   798 KVGFYKKHPNIPEELSANAKNFILRCFAISVMDRPSASQLLEDPFLQDKPRKVRPALPINTEFGR 862
            :||.||.||.:|..|||.|:.|:||.|......|.||..||.|||||...|...|:.|      |
Human   861 QVGMYKVHPPMPSSLSAEAQAFLLRTFEPDPRLRASAQTLLGDPFLQPGKRSRSPSSP------R 919

  Fly   863 SISVPADRFVHKTTPPLSYNTTCNTPTTPELDITH-------------SSSVDIDELPSNQFMLE 914
            ....|:|......||..:..|...|...|:....|             :|.:.:.|.|:.:    
Human   920 HAPRPSDAPSASPTPSANSTTQSQTFPCPQAPSQHPPSPPKRCLSYGGTSQLRVPEEPAAE---- 980

  Fly   915 RRNSHGFLLSPEIEPSTPSLRTSISETSETDGFYRLKKDSQRRTTLSKVL-----ALDESKICDI 974
                         ||::|         .|:.|...|.::|:||..|:.||     ||.|:     
Human   981 -------------EPASP---------EESSGLSLLHQESKRRAMLAAVLEQELPALAEN----- 1018

  Fly   975 WLKKVDADQNSIAIRKSDLEVLIRGLRDYIMNENEKHLEATINELKQKLNNDAVALDHLHLALYS 1039
             |.:....:....:.::.:|.|:|.|..:|...|.:.|...:..|:.:|....:....||..|::
Human  1019 -LHQEQKQEQGARLGRNHVEELLRCLGAHIHTPNRRQLAQELRALQGRLRAQGLGPALLHRPLFA 1082

  Fly  1040 FQDAVVCVLRYHCIKPHWMFALDNLVKRAVQAAVTIFSPELGANLADKDLSGNDDESLRTSLMQK 1104
            |.|||..:||...|:|||||.||:|:.|||:||:.:..||:     :|:......|.|      .
Human  1083 FPDAVKQILRKRQIRPHWMFVLDSLLSRAVRAALGVLGPEV-----EKEAVSPRSEEL------S 1136

  Fly  1105 GSTESQEKQSLEKVLPTSNTREGVGLTPAESGGDALSSSMECARI----LRDIRDNQQKLQRQLL 1165
            ...:||:....:..||..          .|.|...|...:...|.    ||:|...:::      
Human  1137 NEGDSQQSPGQQSPLPVE----------PEQGPAPLMVQLSLLRAETDRLREILAGKER------ 1185

  Fly  1166 EQQRQSMRALHNISQELAHIYMGGRKRLRRTINGFNKKCHRMSTSVGGTSGVRPNIAGNPRRQLN 1230
            |.|....|||..:::| |..|:                                 :|..|...|:
Human  1186 EYQALVQRALQRLNEE-ARTYV---------------------------------LAPEPPTALS 1216

  Fly  1231 KHHFGLHEVDEQLEQWLTQQEIDEFSKTLILNEGFTFDDFIYNMEKLDLMRLGLRVGIEVRLWKL 1295
                    .|:.|.|||.:..:|..:..::||..||....:....:.||:...:|.|:..|:|:.
Human  1217 --------TDQGLVQWLQELNVDSGTIQMLLNHSFTLHTLLTYATRDDLIYTRIRGGMVCRIWRA 1273

  Fly  1296 IIQERVCTSSDCVDSPP 1312
            |:.:|  ..|..|.|.|
Human  1274 ILAQR--AGSTPVTSGP 1288

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ask1NP_477089.3 DUF4071 74..444 CDD:290020 137/382 (36%)
STKc_ASK 576..843 CDD:270794 184/267 (69%)
S_TKc 590..843 CDD:214567 180/253 (71%)
MAP3K6NP_004663.3 DUF4071 129..506 CDD:290020 137/382 (36%)
STKc_ASK 639..906 CDD:270794 184/267 (69%)
S_TKc 653..906 CDD:214567 180/253 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113131894
eggNOG 1 0.900 E1_KOG4279
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D122434at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T609688
orthoMCL 1 0.900 OOG5_130258
Panther 1 1.100 LDO PTHR11584
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.