DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ask1 and STE11

DIOPT Version :8

Sequence 1:NP_477089.3 Gene:Ask1 / 42366 FlyBaseID:FBgn0014006 Length:1363 Species:Drosophila melanogaster
Sequence 2:NP_013466.1 Gene:STE11 / 851076 SGDID:S000004354 Length:717 Species:Saccharomyces cerevisiae

Alignment Length:858 Identity:204/859 (24%)
Similarity:331/859 (39%) Gaps:273/859 (32%)


  Fly    94 NDIDSKQTLSLKLSCANYL--FLSYKRNAETNSCHLTSQPN-----------SGNN--------- 136
            ||:...|....::.|..||  |:         .|:|.::..           .|.|         
Yeast    20 NDLPFVQLFLEEIGCTQYLDSFI---------QCNLVTEEEIKYLDKDILIALGVNKIGDRLKIL 75

  Fly   137 --SKEPNAEGRVPTLQWRLKRKLQDVEIQSKAHMR-------EK----FLSDMRTARDTYATNGA 188
              ||....:.|:..:. |||..::.|...|.|.:.       ||    |:.:..:|:........
Yeast    76 RKSKSFQRDKRIEQVN-RLKNLMEKVSSLSTATLSMNSELIPEKHCVIFILNDGSAKKVNVNGCF 139

  Fly   189 KLQSILHEMRKRLDDPHVL-----SGEVVHSFMCSLRDVQDYDAMVRLVNDLKNIPNTRKYVETG 248
            ...||...:.:||  ||.|     :|||.       :.|||||..|  ::..||:          
Yeast   140 NADSIKKRLIRRL--PHELLATNSNGEVT-------KMVQDYDVFV--LDYTKNV---------- 183

  Fly   249 NMSFLYAFALNRRNRKGDREKALESSLKALEKKENHFPDMLCLCGRIYKDIFVESDYTDA-TSLA 312
             :..||...|.......||          :||.               :.|||..|.|.: .:::
Yeast   184 -LHLLYDVELVTICHANDR----------VEKN---------------RLIFVSKDQTPSDKAIS 222

  Fly   313 HAIKWYRQSFEVQPNEYAGINLATLLVIEGKEFTNTEELQHIGMTLNNLIGKKGSLSSLSEYWDV 377
            .:.|.|.::....  ...|.:.:.||.            |:.|::.||..||             
Yeast   223 TSKKLYLRTLSAL--SQVGPSSSNLLA------------QNKGISHNNAEGK------------- 260

  Fly   378 ATFFEISVLANDYAKAIQAAECMFKLKPPNWYLKSTIGNISLIHRFRKKPEERQPPIEEQVFQFW 442
               ..|.....|..:.|      |..:||:.::.:.:... ..|...|:                
Yeast   261 ---LRIDNTEKDRIRQI------FNQRPPSEFISTNLAGY-FPHTDMKR---------------- 299

  Fly   443 MDFFLEATNTEEVKNSIRFPILILEPQKIYMPSYVTINMDADEKSIQIVNICLAHAK---NACKK 504
                |:.|..|..::|.|..|....|            :.|:..:|.  :|.|.|:.   .|..:
Yeast   300 ----LQKTMRESFRHSARLSIAQRRP------------LSAESNNIG--DILLKHSNAVDMALLQ 346

  Fly   505 IHDFLFVASKIKSVSLYKRDDRCAYLYVHHNSDDFQIYFPSTERRQKFYDMILEMTADQVVFVNL 569
            ..|...::||:.:..:.|        ..|...:|              .|.|    ::|:..:::
Yeast   347 GLDQTRLSSKLDTTKIPK--------LAHKRPED--------------NDAI----SNQLELLSV 385

  Fly   570 SNDDANIEYEYDYDEQNRKMV-----------------LGKGTYGTVYAARDKQTQVRIAIKEV- 616
            .:.:   |.::|:..::..:|                 :|.|::|:||...:..|...:|:|:| 
Yeast   386 ESGE---EEDHDFFGEDSDIVSLPTKIATPKNWLKGACIGSGSFGSVYLGMNAHTGELMAVKQVE 447

  Fly   617 ------------------PEKNSQD-------------------------VQPLHEEIKLHSQLR 638
                              .|.|.|:                         |..|..|:.|..:|.
Yeast   448 IKNNNIGVPTDNNKQANSDENNEQEEQQEKIEDVGAVSHPKTNQNIHRKMVDALQHEMNLLKELH 512

  Fly   639 HRNIVRYLGSCSENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAFYSKQILEGLKYLHEQD 703
            |.|||.|.|:..|.|...||:|.|||||:|.:| ..:||.:  ||.:..:::|||.|:.|||:::
Yeast   513 HENIVTYYGASQEGGNLNIFLEYVPGGSVSSML-NNYGPFE--ESLITNFTRQILIGVAYLHKKN 574

  Fly   704 IVHRDIKGDNVLVNTYSGVVKISDFGTSKRLARINPMTE---TFTGTLQYMAPEVIDQGVRGYGP 765
            |:||||||.|:|:: ..|.|||:|||.||:|:.:|....   :..|::.:|:|||:.|  .....
Yeast   575 IIHRDIKGANILID-IKGCVKITDFGISKKLSPLNKKQNKRASLQGSVFWMSPEVVKQ--TATTA 636

  Fly   766 AADIWSFGCTNVEMATGKPPFIELGSAHAAMFKVGFYKKHPNIPEELSANAKNFILRCFAISVMD 830
            .|||||.||..:||.|||.||.:. |...|:||:| ....|.||...::..|||:.:.|.:....
Yeast   637 KADIWSTGCVVIEMFTGKHPFPDF-SQMQAIFKIG-TNTTPEIPSWATSEGKNFLRKAFELDYQY 699

  Fly   831 RPSASQLLEDPFL 843
            ||||.:||:.|:|
Yeast   700 RPSALELLQHPWL 712

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ask1NP_477089.3 DUF4071 74..444 CDD:290020 73/391 (19%)
STKc_ASK 576..843 CDD:270794 108/331 (33%)
S_TKc 590..843 CDD:214567 106/317 (33%)
STE11NP_013466.1 SAM_Ste11_fungal 20..82 CDD:188933 13/71 (18%)
Ras_bdg_2 121..224 CDD:291513 32/150 (21%)
PKc_like 415..712 CDD:304357 105/305 (34%)
S_TKc 415..712 CDD:214567 105/305 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2727
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T634785
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R6807
TreeFam 00.000 Not matched by this tool.
32.980

Return to query results.
Submit another query.