DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ask1 and NP2

DIOPT Version :8

Sequence 1:NP_477089.3 Gene:Ask1 / 42366 FlyBaseID:FBgn0014006 Length:1363 Species:Drosophila melanogaster
Sequence 2:NP_001319236.1 Gene:NP2 / 841937 AraportID:AT1G54960 Length:651 Species:Arabidopsis thaliana

Alignment Length:704 Identity:202/705 (29%)
Similarity:300/705 (43%) Gaps:170/705 (24%)


  Fly   535 NSDDFQIYFPSTERRQKFYDMILEMTADQVVFVNLSNDDANIEYEYDYDEQNRK-MVLGKGTYGT 598
            |.::....|||.     ..|.|.......:||....:...|...:.....:.|| .::|:|.:||
plant    22 NQENHPPPFPSL-----LADKITSCIRKSMVFAKSQSPPNNSTVQIKPPIRWRKGQLIGRGAFGT 81

  Fly   599 VYAARDKQTQVRIAIKEV--------PEKNSQDVQPLHEEIKLHSQLRHRNIVRYLGSCSENGFF 655
            ||...:..:...:|:|:|        .||....:|.|.||:||...|.|.|||||||:..|:...
plant    82 VYMGMNLDSGELLAVKQVLITSNCASKEKTQAHIQELEEEVKLLKNLSHPNIVRYLGTVREDETL 146

  Fly   656 KIFMEQVPGGSLSDLLETKWGPLKDNESTMAFYSKQILEGLKYLHEQDIVHRDIKGDNVLVNTYS 720
            .|.:|.|||||:|.||| |:|...  ||.:..|:.|:|.||:|||...|:||||||.|:||:. .
plant   147 NILLEFVPGGSISSLLE-KFGAFP--ESVVRTYTNQLLLGLEYLHNHAIMHRDIKGANILVDN-Q 207

  Fly   721 GVVKISDFGTSKRLARINPMT--ETFTGTLQYMAPEVIDQGVRGYGPAADIWSFGCTNVEMATGK 783
            |.:|::|||.||::|.:..::  ::..||..:||||||.|  .|:..:|||||.|||.:||.|||
plant   208 GCIKLADFGASKQVAELATISGAKSMKGTPYWMAPEVILQ--TGHSFSADIWSVGCTVIEMVTGK 270

  Fly   784 PPFIELGSAHAAMFKVGFYKKHPNIPEELSANAKNFILRCFAISVMDRPSASQLLEDPFLQDKPR 848
            .|:.:.....||:|.:|..|.||.||:.:|::|.:|:|:|.......||:||:||:.||:..|.:
plant   271 APWSQQYKEIAAIFHIGTTKSHPPIPDNISSDANDFLLKCLQQEPNLRPTASELLKHPFVTGKQK 335

  Fly   849 KVRPALPINTEFGRSISVPADRFVHKTTPPL--------SYNTT--------CN------TPTTP 891
            :             |.|.....|:..:..||        ||.|:        ||      |...|
plant   336 E-------------SASKDLTSFMDNSCSPLPSELTNITSYQTSTSDDVGDICNLGSLTCTLAFP 387

  Fly   892 ELDITHSS-------SVDIDELPSNQFMLERRNSHGFLLSPEIEPSTPSLRTSISETSETDGFYR 949
            |..|.::|       ..|.|: .::..:::..|   ||        |.:..|..|..:.||.   
plant   388 EKSIQNNSLCLKSNNGYDDDD-DNDMCLIDDEN---FL--------TYNGETGPSLDNNTDA--- 437

  Fly   950 LKKDSQRRTTLSKVLALDESKICDIWLKKVDADQNS---IAIRKSDLEVLIRGLRDYIMNENEKH 1011
             ||.....:.:|.:|             |...|:||   ....|..:||   ....|..:||   
plant   438 -KKSCDTMSEISDIL-------------KCKFDENSGNGETETKVSMEV---DHPSYSEDEN--- 482

  Fly  1012 LEATINELKQKLNNDAVALDHLHLALYS--FQDAVVCVLRYHCIKPHWMFALDNLVK-------- 1066
             |.|.:::|..|::.|..|..|...||.  :...:.|       .|..|.:..|..|        
plant   483 -ELTESKIKAFLDDKAAELKKLQTPLYEEFYNGMITC-------SPICMESNINNNKREEAPRGF 539

  Fly  1067 --------------------RAVQAAVTIFSPELGANLADKDLSGNDDESLRTSLMQKGSTESQE 1111
                                ||..||....|||          |||...:.:.|....|:.:...
plant   540 LKLPPKSRSPSQGHIGRSPSRATDAACCSKSPE----------SGNSSGAPKNSNASAGAEQESN 594

  Fly  1112 KQS-----------------LEKVLPTSNTREGVGLTPAESGGDALSSSMECAR 1148
            .||                 ||:.......:.|:|.:|.:.   :||...|.:|
plant   595 SQSVALSEIERKWKEELDQELERKRREITRQAGMGSSPRDR---SLSRHREKSR 645

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ask1NP_477089.3 DUF4071 74..444 CDD:290020
STKc_ASK 576..843 CDD:270794 116/278 (42%)
S_TKc 590..843 CDD:214567 114/263 (43%)
NP2NP_001319236.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T125183
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.