DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ask1 and MAPKKK6

DIOPT Version :8

Sequence 1:NP_477089.3 Gene:Ask1 / 42366 FlyBaseID:FBgn0014006 Length:1363 Species:Drosophila melanogaster
Sequence 2:NP_187455.1 Gene:MAPKKK6 / 819989 AraportID:AT3G07980 Length:1367 Species:Arabidopsis thaliana

Alignment Length:671 Identity:173/672 (26%)
Similarity:278/672 (41%) Gaps:158/672 (24%)


  Fly   555 MILEMTADQVVFVNLSNDDANIEYEYDYDEQNRKMVLGKGTYGTVYAARDKQTQVRIAIKEVPEK 619
            |..:||:.|.      :....::.:|...::     :|||.||.||...|.:....:|||:|..:
plant     1 MARQMTSSQF------HKSKTLDNKYMLGDE-----IGKGAYGRVYIGLDLENGDFVAIKQVSLE 54

  Fly   620 N--SQDVQPLHEEIKLHSQLRHRNIVRYLGSCSENGFFKIFMEQVPGGSLSDLLE-TKWGPLKDN 681
            |  .:|:..:.:||.|...|.|:|||:||||........|.:|.|..|||::::: .|:||..  
plant    55 NIGQEDLNTIMQEIDLLKNLNHKNIVKYLGSLKTKTHLHIILEYVENGSLANIIKPNKFGPFP-- 117

  Fly   682 ESTMAFYSKQILEGLKYLHEQDIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLARINPMTETFTG 746
            ||.:..|..|:||||.|||||.::||||||.|:| .|..|:||::|||.:.:|...:..|.:..|
plant   118 ESLVTVYIAQVLEGLVYLHEQGVIHRDIKGANIL-TTKEGLVKLADFGVATKLNEADFNTHSVVG 181

  Fly   747 TLQYMAPEVIDQGVRGYGPAADIWSFGCTNVEMATGKPPFIELGSAHAAMFKVGFYKKHPNIPEE 811
            |..:||||||:  :.|...|:||||.|||.:|:.|..||:.:| ....|:::: .....|.||:.
plant   182 TPYWMAPEVIE--LSGVCAASDIWSVGCTIIELLTCVPPYYDL-QPMPALYRI-VQDDTPPIPDS 242

  Fly   812 LSANAKNFILRCFAISVMDRPSASQLLEDPFLQDKPRKVRPALPINTEFGRSISVPADRFVHKTT 876
            ||.:..:|:..||......||.|..||..|::::..|.:|.:|.                 |..|
plant   243 LSPDITDFLRLCFKKDSRQRPDAKTLLSHPWIRNSRRALRSSLR-----------------HSGT 290

  Fly   877 PPLSYNTTCNTPTTPELDITHSSSVDIDELPSNQFMLERRNSH-------GFLLSPEIEPSTPSL 934
              :.|..  .|.::.|.|...|..| ::.:.:.:..:.:.||.       |.....|.:.|:||.
plant   291 --IRYMK--ETDSSSEKDAEGSQEV-VESVSAEKVEVTKTNSKSKLPVIGGASFRSEKDQSSPSD 350

  Fly   935 RTSISETSETDGFYRLKKDSQRRTTLSKVLALDESKICDIWLKKVDADQNSIAIRKSDLEVLIRG 999
            .......||.|      .:|.:..|||              :....:.|:......||    .:|
plant   351 LGEEGTDSEDD------INSDQGPTLS--------------MHDKSSRQSGTCSISSD----AKG 391

  Fly  1000 LRDYIMNENEKH-------------LEATINELKQKLNNDAVALDHLHLALYSFQDAVVCVLRYH 1051
            ....::..:||:             .|...|.|..||.....::...|......:|.        
plant   392 TSQDVLENHEKYDRDEIPGNLETEASEGRRNTLATKLVGKEYSIQSSHSFSQKGEDG-------- 448

  Fly  1052 CIKPHWMFALDNLVKRAVQA-------AVTIFS-PELGANL------ADKDLSGNDDESLRTSLM 1102
                         :::||:.       .:|.|| |...|:|      .||...|..:|:      
plant   449 -------------LRKAVKTPSSFGGNELTRFSDPPGDASLHDLFHPLDKVPEGKTNEA------ 494

  Fly  1103 QKGSTESQEKQSLEKVLPTSNTREGVGLTPAESGGDALSSSMECARILRDIRDNQQKLQRQLLEQ 1167
               ||.:          ||:|..:|.  :|...||.               .|...||:.::.::
plant   495 ---STST----------PTANVNQGD--SPVADGGK---------------NDLATKLRARIAQK 529

  Fly  1168 QRQSMRALHNISQELAHIYMG 1188
            |.:..........:|..:.||
plant   530 QMEGETGHSQDGGDLFRLMMG 550

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ask1NP_477089.3 DUF4071 74..444 CDD:290020
STKc_ASK 576..843 CDD:270794 103/270 (38%)
S_TKc 590..843 CDD:214567 102/256 (40%)
MAPKKK6NP_187455.1 STKc_Cdc7_like 19..274 CDD:270797 103/267 (39%)
S_TKc 20..274 CDD:214567 103/266 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T125183
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.