DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ask1 and NP3

DIOPT Version :8

Sequence 1:NP_477089.3 Gene:Ask1 / 42366 FlyBaseID:FBgn0014006 Length:1363 Species:Drosophila melanogaster
Sequence 2:NP_187254.1 Gene:NP3 / 819774 AraportID:AT3G06030 Length:651 Species:Arabidopsis thaliana

Alignment Length:646 Identity:193/647 (30%)
Similarity:296/647 (46%) Gaps:114/647 (18%)


  Fly   590 VLGKGTYGTVYAARDKQTQVRIAIKEV--------PEKNSQDVQPLHEEIKLHSQLRHRNIVRYL 646
            ::|.|.:|.||...:..:...:|||:|        .||....::.|.||::|...|.|.||||||
plant    73 LIGCGAFGRVYMGMNLDSGELLAIKQVLIAPSSASKEKTQGHIRELEEEVQLLKNLSHPNIVRYL 137

  Fly   647 GSCSENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAFYSKQILEGLKYLHEQDIVHRDIKG 711
            |:..|:....|.||.|||||:|.||| |:|...  |..:..|:||:|.||:|||...|:||||||
plant   138 GTVRESDSLNILMEFVPGGSISSLLE-KFGSFP--EPVIIMYTKQLLLGLEYLHNNGIMHRDIKG 199

  Fly   712 DNVLVNTYSGVVKISDFGTSKR---LARINPMTETFTGTLQYMAPEVIDQGVRGYGPAADIWSFG 773
            .|:||:. .|.::::|||.||:   ||.:|. .::..||..:||||||.|  .|:..:|||||.|
plant   200 ANILVDN-KGCIRLADFGASKKVVELATVNG-AKSMKGTPYWMAPEVILQ--TGHSFSADIWSVG 260

  Fly   774 CTNVEMATGKPPFIELGSAHAAMFKVGFYKKHPNIPEELSANAKNFILRCFAISVMDRPSASQLL 838
            ||.:||||||||:.|.....||:..:|..|.||.|||:||..||:|:::|.......|.||::||
plant   261 CTVIEMATGKPPWSEQYQQFAAVLHIGRTKAHPPIPEDLSPEAKDFLMKCLHKEPSLRLSATELL 325

  Fly   839 EDPFLQDKPRKVRPALPIN-TEFGRSISVPADRFVHKTTPPLSYNTTCNTPTTPELDITHSSSVD 902
            :.||:..|.::..||...: ||.|..|:..... |..:...|...:||            |...|
plant   326 QHPFVTGKRQEPYPAYRNSLTECGNPITTQGMN-VRSSINSLIRRSTC------------SGLKD 377

  Fly   903 IDELPSNQFML---ERRNSHGFLLSPEIEPSTPSLRTSIS-ETSETDGFYRLKKDSQRRTTLSKV 963
            :.||.|.:..:   ::.|:.||           ..|...| :..:||.......:|.|...||:.
plant   378 VCELGSLRSSIIYPQKSNNSGF-----------GWRDGDSDDLCQTDMDDLCNIESVRNNVLSQS 431

  Fly   964 LALDES--KICDI---WLKKVDADQNSIAIRKSDLEVLIRGLRDYIMNENEKHL----------- 1012
            ..|::|  .:||.   |..|.|.....:..:.:.|......|:..:..:.|..|           
plant   432 TDLNKSFNPMCDSTDNWSCKFDESPKVMKSKSNLLSYQASQLQTGVPCDEETSLTFAGGSSVAED 496

  Fly  1013 --EATINELKQKLNNDAVALDHLHLALY-SFQDAVVCVLRYHCIKPHWMFALDNL------VKRA 1068
              :.|..::|..|:..|..|..|...|. .|.:|:...:....:....::.|.||      .||.
plant   497 DYKGTELKIKSFLDEKAQDLKRLQTPLLEEFHNAMNPGIPQGALGDTNIYNLPNLPSISKTPKRL 561

  Fly  1069 VQAAVTIFSPELGANLADKDLSGNDDESLRTS-LMQKGSTESQEKQSLEKVLPTSNTREGVGLTP 1132
            ....::..|..:.:.|.      :...:|.|| :||.|:..:|..:|         |::||    
plant   562 PSRRLSAISDAMPSPLK------SSKRTLNTSRVMQSGTEPTQVNES---------TKKGV---- 607

  Fly  1133 AESGGDALSSSMECARILRDIRDNQQKLQRQLLEQQRQSMRALHNISQELAHIYMGGRKRL 1193
                        ..:|...:||...::...:.||:.|:::|          |...||:..|
plant   608 ------------NNSRCFSEIRRKWEEELYEELERHRENLR----------HAGAGGKTPL 646

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ask1NP_477089.3 DUF4071 74..444 CDD:290020
STKc_ASK 576..843 CDD:270794 117/264 (44%)
S_TKc 590..843 CDD:214567 117/264 (44%)
NP3NP_187254.1 STKc_MAPKKK 67..330 CDD:270783 117/264 (44%)
S_TKc 68..330 CDD:214567 117/264 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T125183
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.