DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ask1 and Map3k6

DIOPT Version :8

Sequence 1:NP_477089.3 Gene:Ask1 / 42366 FlyBaseID:FBgn0014006 Length:1363 Species:Drosophila melanogaster
Sequence 2:NP_057902.5 Gene:Map3k6 / 53608 MGIID:1855691 Length:1291 Species:Mus musculus

Alignment Length:1302 Identity:481/1303 (37%)
Similarity:688/1303 (53%) Gaps:153/1303 (12%)


  Fly    41 FERLDFGETNVLETFYNADVAIIDLSILTQQRPLSYHYGVRESFGMKENILTYNDIDSKQTLSLK 105
            |..|..|:|..|::||||||.::::|....|..|.||.||||||.|..|:|..:..:.....:|:
Mouse    97 FATLALGDTAALDSFYNADVVVLEVSSSLAQPSLFYHLGVRESFSMTNNVLLCSQAELPDLQALR 161

  Fly   106 -------LSC-ANYLFLSYKRNAE----TNSCHLTSQPNSGNNSKEPNAEGRVPTLQWRLKRKLQ 158
                   ..| .:|..:.|...|.    .....|......|........|..:..|..||.|.|:
Mouse   162 EDVFQKNSDCVGSYTLIPYVVTATGRVLCGDAGLLRGIADGLVQAGAGTEALLTPLVGRLVRLLE 226

  Fly   159 DVEIQSKAHMREKFLSDMRTARDTYATNGAKLQSILHEMRKRLDDPHVLSGEVVHSFMCSLRDVQ 223
            .....|..:.||....|:|.||:.:  :|.:|:..|..:::|||...:||.::|.:.:.|.||||
Mouse   227 ATPTDSCGYFRETIRQDIRQARERF--SGQQLRQELARLQRRLDSVELLSPDIVMNLLLSYRDVQ 289

  Fly   224 DYDAMVRLVNDLKNIPNTRKYVETGNMSFLYAFALNRRNRKGDREKALESSLKALEKKENHFPDM 288
            ||.|::.||..|:.:| |....|..|:.|.|.||||||||.|||||||...|..::.:....||:
Mouse   290 DYSAIIELVETLQALP-TCDVAEQHNVCFHYTFALNRRNRPGDREKALAVLLPLVKYEGPVAPDL 353

  Fly   289 LCLCGRIYKDIFVESDYTDATSLAHAIKWYRQSFEVQPNEYAGINLATLLVIEGKEFTNTEELQH 353
            .|:|||||||:|..|.:.:|..|..|..|||::|:|:|:.::|||.|.||:..|:.|.::|||:.
Mouse   354 YCMCGRIYKDMFFTSGFQNAGHLEQAYHWYRKAFDVEPSLHSGINAAVLLIAAGQHFEDSEELRL 418

  Fly   354 IGMTLNNLIGKKGSLSSLSEYWDVATFFEISVLANDYAKAIQAAECMFKLKPPNWYLKSTIGNIS 418
            |||.|..|:.:||.:..:..||||..:....:||||..:.:.|||.::||..|.|||.|.:....
Mouse   419 IGMKLACLLARKGCVEKMQYYWDVGFYLGAQILANDPIQVVLAAEQLYKLNAPIWYLVSVMETFL 483

  Fly   419 LIHRFRKKPE-ERQPPIEEQVFQFWMDFFLEATNTEEV--KNSIRFPILILEPQKIYMPSYVTIN 480
            |...||..|| ...||:..   .||:.|.|::....::  ....:..:|:||..|:.:|:.:.|.
Mouse   484 LYQHFRPTPEPSGGPPLRA---HFWLHFLLQSCQPFKMAPPQEDQCLVLVLEINKVLLPARLEIQ 545

  Fly   481 MDADEKSIQIVNICLAHAKNACKKIHDFLFVASKIKSVSLYKRDDRCAYLYVHHNSDDFQIYFPS 545
               ....:..|.:.|...:.. :....:.|..:.|..:|..|.|.||.:||....:.|.|:.|||
Mouse   546 ---GTDPVSTVTLSLLDPETQ-EDPSSWTFPVTSICGISTSKLDQRCCFLYALPPAQDVQLCFPS 606

  Fly   546 TERRQKFYDMILEMTADQVVFVN----LSNDDAN-----IEYEYDYDEQNRKMVLGKGTYGTVYA 601
            .||.|:|..:|      ||:.:|    ...::|.     :|::|:|.|...::|||:||||.|||
Mouse   607 VERCQRFCGLI------QVLVMNPDSSAPTEEAEGAREVLEFDYEYSETGERLVLGRGTYGVVYA 665

  Fly   602 ARDKQTQVRIAIKEVPEKNSQDVQPLHEEIKLHSQLRHRNIVRYLGSCSENGFFKIFMEQVPGGS 666
            .||:.|:|||||||:||::|:..|||||||.||.:|||:||||||||.|:.|:.|||||:|||||
Mouse   666 GRDRHTRVRIAIKEIPERDSRFSQPLHEEIALHKRLRHKNIVRYLGSASQGGYLKIFMEEVPGGS 730

  Fly   667 LSDLLETKWGPLKDNESTMAFYSKQILEGLKYLHEQDIVHRDIKGDNVLVNTYSGVVKISDFGTS 731
            ||.||.:.||||||||||::||::|||:||.||||..||||||||||||:||:||::||||||||
Mouse   731 LSSLLRSVWGPLKDNESTISFYTRQILQGLSYLHENRIVHRDIKGDNVLINTFSGLLKISDFGTS 795

  Fly   732 KRLARINPMTETFTGTLQYMAPEVIDQGVRGYGPAADIWSFGCTNVEMATGKPPFIELGSAHAAM 796
            ||||.|.|.||||||||||||||:||||.||||.||||||.|||.:|||||:|||.||||..|||
Mouse   796 KRLAGITPCTETFTGTLQYMAPEIIDQGPRGYGKAADIWSLGCTVIEMATGRPPFHELGSPQAAM 860

  Fly   797 FKVGFYKKHPNIPEELSANAKNFILRCFAISVMDRPSASQLLEDPFLQDKPRKVRPALPINTEFG 861
            |:||.||.||.:|..|||.|:.|:||.|......|.||.:||.|||||...|...|..|.:|.  
Mouse   861 FQVGMYKVHPPVPGSLSAEAQAFLLRTFEPDPRLRASAQELLGDPFLQPGKRSRSPGSPRHTP-- 923

  Fly   862 RSISVP-------ADRFVHKTTPPLSYNTTCNTPTTPE--LDITHSSSVDIDELPSNQFMLERRN 917
            |....|       ||......|.|.....:.:.|:.|:  |....:|.:.:.|.|:.:       
Mouse   924 RPSGAPSGPSSPSADSATQSQTFPRPQAPSQHPPSPPKRCLSYGDTSQLRVPEEPAAE------- 981

  Fly   918 SHGFLLSPEIEPSTPSLRTSISETSETDGFYRLKKDSQRRTTLSKVLALDESKICDIWLKKVDAD 982
                      ||::|         .|:.|...|.::|:||..|:.||   |.::..:....::.:
Mouse   982 ----------EPASP---------EESSGLSLLHQESKRRAMLAAVL---EQEVPTLAENLLEQE 1024

  Fly   983 QNSIAIRKSDLEVLIRGLRDYIMNENEKHLEATINELKQKLNNDAVALDHLHLALYSFQDAVVCV 1047
            |:| .:.|..:|:|:|.|...|...|.:.|...:..|:.:|...::....|...|::|.|||..:
Mouse  1025 QDS-RLSKIHVELLLRCLGAQIHTPNRRQLAQELRTLQAQLRAQSLGPALLKGPLFAFPDAVKQI 1088

  Fly  1048 LRYHCIKPHWMFALDNLVKRAVQAAVTIFSPELGANLADKDLSGNDDESLRTSLMQKGSTESQEK 1112
            ||...|:|||||.||:|:.|||:||:.:    |.|....|.:....:||.:....||    .||.
Mouse  1089 LRRRQIRPHWMFVLDSLLSRAVRAAMAV----LDAESEKKAVLPRSEESSKEESQQK----PQES 1145

  Fly  1113 QSLEKVLPTSNTREGVGLTPAESGGDALSSSMECARI----LRDIRDNQQKLQRQLLEQQRQSMR 1173
            |:|:..|            |.|.|..:|...:...|.    |||:...:::..:.|::|      
Mouse  1146 QALQSQL------------PPEQGPPSLMVELGLLRAETDRLRDLLAEKERECQALVQQ------ 1192

  Fly  1174 ALHNISQELAHIYMGGRKRLRRTINGFNKKCHRMSTSVGGTSGVRPNIAGNPRRQLNKHHFGLHE 1238
            |||.:..|.                       |.......|....|.                  
Mouse  1193 ALHRVHAET-----------------------RKYAPASETPATLPK------------------ 1216

  Fly  1239 VDEQLEQWLTQQEIDEFSKTLILNEGFTFDDFIYNMEKLDLMRLGLRVGIEVRLWKLIIQERVCT 1303
             |:.|.:||.:..:|..:...:|:..||....:....:.||:...:|.|:..|:|:.|:.:|...
Mouse  1217 -DQNLVRWLQELSVDPATIQTLLSHSFTLQTLLTCATQDDLVYTRIRGGMVCRIWRAILAQRAGA 1280

  Fly  1304 SS 1305
            :|
Mouse  1281 TS 1282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ask1NP_477089.3 DUF4071 74..444 CDD:290020 140/383 (37%)
STKc_ASK 576..843 CDD:270794 184/267 (69%)
S_TKc 590..843 CDD:214567 180/253 (71%)
Map3k6NP_057902.5 DUF4071 130..507 CDD:290020 140/383 (37%)
STKc_ASK 640..907 CDD:270794 184/267 (69%)
S_TKc 654..907 CDD:214567 180/253 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113131827
eggNOG 1 0.900 E1_KOG4279
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T616506
orthoMCL 1 0.900 OOG5_130258
Panther 1 1.100 LDO PTHR11584
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.790

Return to query results.
Submit another query.