DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ask1 and Map3k15

DIOPT Version :8

Sequence 1:NP_477089.3 Gene:Ask1 / 42366 FlyBaseID:FBgn0014006 Length:1363 Species:Drosophila melanogaster
Sequence 2:XP_001054480.3 Gene:Map3k15 / 501558 RGDID:1560603 Length:1327 Species:Rattus norvegicus

Alignment Length:1331 Identity:576/1332 (43%)
Similarity:786/1332 (59%) Gaps:145/1332 (11%)


  Fly    21 ALEEIKQAVQSAGANFQRVQFERLDFGETNVLETFYNADVAIIDLSILTQQRPLSYHYGVRESFG 85
            ||:.:.:|.::.||:...|.|..||||||.||:.||:|||||:|:|.:::|..|.||.||||||.
  Rat    83 ALKCLLRACEAEGAHLTSVPFGELDFGETAVLDAFYDADVAIVDMSDISRQPSLFYHLGVRESFD 147

  Fly    86 MKENILTYNDIDSKQTLSLK--------LSCANYLFLSYKRN--AETNSCHLTSQPNSGNNSKEP 140
            |..|::.|.|.|:...||||        .|..||.|:.|...  |:...|...:| ...:...:|
  Rat   148 MANNVILYYDTDADTALSLKDMVTQKNIASSGNYYFIPYTVTPCADYFCCESDAQ-RRASEYMQP 211

  Fly   141 NAEGRVPTLQW-------------RLKRKLQDVEIQSKAHMREKFLSDMRTARDTYATNGAKLQS 192
            |         |             |....|:|:.:.|.|:.:|..|:|:|.||:.|  .|.:|..
  Rat   212 N---------WDTILGPLCMPLVDRFTTLLKDIRVTSCAYYKETLLNDIRKAREKY--QGDELAK 265

  Fly   193 ILHEMRKRLDDPHVLSGEVVHSFMCSLRDVQDYDAMVRLVNDLKNIPNTRKYVETGNMSFLYAFA 257
            .|..::.|:|:..||:.:::.:.:.|.||:|||||||:||..||.:| |....:..|:.|.||||
  Rat   266 ELTRIKFRMDNIEVLTSDIIINLLLSYRDIQDYDAMVKLVETLKMLP-TCDLADQHNIKFHYAFA 329

  Fly   258 LNRRNRKGDREKALESSLKALEKKENHFPDMLCLCGRIYKDIFVESDYTDATSLAHAIKWYRQSF 322
            |||||..|||||||:..|:.|...::..|||.|||||||||||::|...:..|...||:|||:.|
  Rat   330 LNRRNSTGDREKALQVMLQVLRSCDHPAPDMFCLCGRIYKDIFLDSGCEEDASRDSAIEWYRKGF 394

  Fly   323 EVQPNEYAGINLATLLVIEGKEFTNTEELQHIGMTLNNLIGKKGSLSSLSEYWDVATFFEISVLA 387
            |:|.:.|:|||||.||::.|::|..:.||:.||:.||:|:|:||||..::.||||..||.:|:||
  Rat   395 ELQSSLYSGINLAVLLIVSGQQFETSMELRKIGVRLNSLLGRKGSLEKMNNYWDVGQFFTVSMLA 459

  Fly   388 NDYAKAIQAAECMFKLKPPNWYLKSTIGNISLIHRFRKKPEERQPPIEEQVFQFWMDFFLEATNT 452
            :|..||:||||.:||||||.|||:|.:.|:.||.|| |||.....|.:|:: .||:|...|||| 
  Rat   460 SDIGKAVQAAERLFKLKPPVWYLRSLVQNLLLIQRF-KKPITEHSPRQERL-NFWLDIIFEATN- 521

  Fly   453 EEVKNSIRFPILILEPQKIYMPSYVTINMDADEKSIQIVNICLAHAKNACKKIHDFLFVASKIKS 517
             ||.|.:|||:|::||.|||.|:||:||.:|:|:::.:.::    :....|:||::.|.||.||.
  Rat   522 -EVTNGLRFPVLVIEPTKIYQPAYVSINNEAEERTVSLWHV----SPTEMKQIHEWNFTASSIKG 581

  Fly   518 VSLYKRDDRCAYLYVHHNSDDFQIYFPSTERRQKFYDMILEMTADQV---VFVNLSNDDANIEYE 579
            :||.|.|:||.:||||.|||||||||.:.|:..:|..::.||..:.|   |.:....|...:|||
  Rat   582 ISLSKFDERCCFLYVHDNSDDFQIYFSTEEQCNRFCSLVKEMLNNGVGSTVELEGEADGDTLEYE 646

  Fly   580 YDYDEQNRKMVLGKGTYGTVYAARDKQTQVRIAIKEVPEKNSQDVQPLHEEIKLHSQLRHRNIVR 644
            ||:|....::|||||:||.|||.||...||||||||:||::.:..|||||||.||..|:|||||:
  Rat   647 YDHDVNGERVVLGKGSYGVVYAGRDLSNQVRIAIKEIPERDIRYSQPLHEEIALHKYLKHRNIVQ 711

  Fly   645 YLGSCSENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAFYSKQILEGLKYLHEQDIVHRDI 709
            ||||.||||:.|||||||||||||.||.:||||:|  |.|:.||:||||||||||||..||||||
  Rat   712 YLGSVSENGYIKIFMEQVPGGSLSALLRSKWGPMK--EPTIKFYTKQILEGLKYLHENQIVHRDI 774

  Fly   710 KGDNVLVNTYSGVVKISDFGTSKRLARINPMTETFTGTLQYMAPEVIDQGVRGYGPAADIWSFGC 774
            ||||||||||||||||||||||||||.|||.||||||||||||||:||||.||||..|||||.||
  Rat   775 KGDNVLVNTYSGVVKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDQGPRGYGAPADIWSLGC 839

  Fly   775 TNVEMATGKPPFIELGSAHAAMFKVGFYKKHPNIPEELSANAKNFILRCFAISVMDRPSASQLLE 839
            |.:||||.:|||.|||...|||||||.:|.||.|||.|||.|:.|||.||......|.:|:.||:
  Rat   840 TIIEMATSRPPFHELGEPQAAMFKVGMFKIHPEIPEALSAEARAFILSCFEPDPQKRVTAADLLQ 904

  Fly   840 DPFLQ--DKPRKVRPALPINTEFGRSISVPADRFVHKTTPPLSYNT-TCNTPTTPELDITHSS-- 899
            :.||:  :|.:|                   :|...|.:..:...| |...|::.||..:.||  
  Rat   905 EGFLRQVNKGKK-------------------NRIAFKPSEGVRSGTGTLALPSSGELMGSSSSEH 950

  Fly   900 ---SVDIDELPSNQF----MLERRNSHGFLLSPEIEPSTPSLRTSISETSETD-GFYRLKKDSQR 956
               |.|.|..|...|    :.:.:.||  |||...|.|....|::.....|.| |.:.|:|||:|
  Rat   951 GSISPDSDAQPDAFFEKVQVPKPQLSH--LLSVPDESSALDDRSTALPPEERDPGLFLLRKDSER 1013

  Fly   957 RTTLSKVLALDESKICDIWLKKVDADQNSIAIRKSDLEVLIRGLRDYIMNENEKHLEATINELKQ 1021
            |..|.::|..:::::.....:.|......:.:....::.:|..|||:|.:...:.:.|||::||.
  Rat  1014 RAILYRILWEEQNQVASNLQECVVQSSEELLLSVGHIKQIIGILRDFIRSPEHRVMAATISKLKV 1078

  Fly  1022 KLNNDAVALDHLHLALYSFQDAVVCVLRYHCIKPHWMFALDNLVKRAVQAAVTIFSPELGANL-- 1084
            .|:.|:.:::.:||.|:.|||||..:||.|.|:||||||:||:::|||||||.|..|||.|:.  
  Rat  1079 DLDFDSSSINQIHLILFGFQDAVNRILRNHLIRPHWMFAMDNIIRRAVQAAVAILIPELQAHFEP 1143

  Fly  1085 ------ADKDLSGNDDESLRTSLMQKGSTESQEKQSLEKVLPTSNTREGVGLTPAESGGDALSSS 1143
                  .|||.....|..|...|.|            |..:.|..||.| .:...|........|
  Rat  1144 ASETEGVDKDTEMERDYPLVDLLSQ------------EVHVTTRGTRHG-SVAIQEGQPHQQDPS 1195

  Fly  1144 MECARILRDIRDNQQKLQRQLLEQQRQSMRALHNI----SQELAHIYMGGRKRLRRTINGFNKKC 1204
            ::    |..:|....:|...|::::|:....|..|    :|||.|:.:             ..||
  Rat  1196 LQ----LSKLRQETNRLWEHLVQKEREYQNLLRLILEQKTQELYHLQL-------------QYKC 1243

  Fly  1205 HRMSTSVGGTSGVRPNIAGNPRRQLNKHHFGLHEVDEQLEQWLTQQEIDEFSKTLILNEGFTFDD 1269
            :      |||....|             |.|| ..:.:|..||..|.:|..:...|:.|.:|..|
  Rat  1244 N------GGTENPPP-------------HDGL-GTNRELIDWLQLQGVDANTIEKIVEEDYTLSD 1288

  Fly  1270 FIYNMEKLDLMRLGLRVGIEVRLWKLIIQER 1300
            .:.::.|.||..|.||.|:..|||..:.|.|
  Rat  1289 ILNDITKEDLRCLRLRGGVLCRLWHAVSQHR 1319

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ask1NP_477089.3 DUF4071 74..444 CDD:290020 168/393 (43%)
STKc_ASK 576..843 CDD:270794 189/267 (71%)
S_TKc 590..843 CDD:214567 183/253 (72%)
Map3k15XP_001054480.3 DUF4071 136..514 CDD:290020 168/393 (43%)
STKc_ASK 643..908 CDD:270794 189/267 (71%)
S_TKc 657..908 CDD:214567 183/253 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H50401
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D122434at33208
OrthoFinder 1 1.000 FOG0001961
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11584
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.