DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ask1 and MAP3K15

DIOPT Version :8

Sequence 1:NP_477089.3 Gene:Ask1 / 42366 FlyBaseID:FBgn0014006 Length:1363 Species:Drosophila melanogaster
Sequence 2:NP_001001671.3 Gene:MAP3K15 / 389840 HGNCID:31689 Length:1313 Species:Homo sapiens

Alignment Length:1334 Identity:574/1335 (43%)
Similarity:786/1335 (59%) Gaps:151/1335 (11%)


  Fly    10 AVGDHLEDRQCALEEIKQAVQSAGANFQRVQFERLDFGETNVLETFYNADVAIIDLSILTQQRPL 74
            |.|.....|||.|    :|.::.||:...|.|..||||||.||:.||:||||::|:|.:::|..|
Human    76 AGGPEAGARQCLL----RACEAEGAHLTSVPFGELDFGETAVLDAFYDADVAVVDMSDVSRQPSL 136

  Fly    75 SYHYGVRESFGMKENILTYNDIDSKQTLSLK--------LSCANYLFLSY--KRNAETNSCHLTS 129
            .||.||||||.|..|::.|:|.|:...||||        .|..||.|:.|  ...|:...|...:
Human   137 FYHLGVRESFDMANNVILYHDTDADTALSLKDMVTQKNTASSGNYYFIPYIVTPCADYFCCESDA 201

  Fly   130 QPNSGNNSKEPNAEGRVPTLQWRLKRK----LQDVEIQSKAHMREKFLSDMRTARDTYATNGAKL 190
            | ...:...:||.:..:..|...|..:    |:|:.:.|..:.:|..|:|:|.||:.|  .|.:|
Human   202 Q-RRASEYMQPNWDNILGPLCMPLVDRFISLLKDIHVTSCVYYKETLLNDIRKAREKY--QGEEL 263

  Fly   191 QSILHEMRKRLDDPHVLSGEVVHSFMCSLRDVQDYDAMVRLVNDLKNIPNTRKYVETGNMSFLYA 255
            ...|..::.|:|:..||:.:::.:.:.|.||:|||||||:||..|:.:| |....:..|:.|.||
Human   264 AKELARIKLRMDNTEVLTSDIIINLLLSYRDIQDYDAMVKLVETLEMLP-TCDLADQHNIKFHYA 327

  Fly   256 FALNRRNRKGDREKALESSLKALEKKENHFPDMLCLCGRIYKDIFVESDYTDATSLAHAIKWYRQ 320
            |||||||..|||||||:..|:.|:..::..|||.|||||||||||::||..|.||...||:|||:
Human   328 FALNRRNSTGDREKALQIMLQVLQSCDHPGPDMFCLCGRIYKDIFLDSDCKDDTSRDSAIEWYRK 392

  Fly   321 SFEVQPNEYAGINLATLLVIEGKEFTNTEELQHIGMTLNNLIGKKGSLSSLSEYWDVATFFEISV 385
            .||:|.:.|:|||||.||::.|::|..:.||:.||:.||:|:|:||||..::.||||..||.:|:
Human   393 GFELQSSLYSGINLAVLLIVAGQQFETSLELRKIGVRLNSLLGRKGSLEKMNNYWDVGQFFSVSM 457

  Fly   386 LANDYAKAIQAAECMFKLKPPNWYLKSTIGNISLIHRFRKKPEERQPPIEEQVFQFWMDFFLEAT 450
            ||:|..||:||||.:||||||.|||:|.:.|:.||.||:|...|..|  .::...||:|...|||
Human   458 LAHDVGKAVQAAERLFKLKPPVWYLRSLVQNLLLIRRFKKTIIEHSP--RQERLNFWLDIIFEAT 520

  Fly   451 NTEEVKNSIRFPILILEPQKIYMPSYVTINMDADEKSIQIVNICLAHAKNACKKIHDFLFVASKI 515
            |  ||.|.:|||:|::||.|:|.||||:||.:|:|:::.:.::    :....|::|::.|.||.|
Human   521 N--EVTNGLRFPVLVIEPTKVYQPSYVSINNEAEERTVSLWHV----SPTEMKQMHEWNFTASSI 579

  Fly   516 KSVSLYKRDDRCAYLYVHHNSDDFQIYFPSTERRQKFYDMILEM---TADQVVFVNLSNDDANIE 577
            |.:||.|.|:||.:||||.|||||||||.:.|:..:|:.::.||   ||...|.:....|...:|
Human   580 KGISLSKFDERCCFLYVHDNSDDFQIYFSTEEQCSRFFSLVKEMITNTAGSTVELEGETDGDTLE 644

  Fly   578 YEYDYDEQNRKMVLGKGTYGTVYAARDKQTQVRIAIKEVPEKNSQDVQPLHEEIKLHSQLRHRNI 642
            ||||:|....::||||||||.|||.||...||||||||:||::|:..|||||||.||..|:||||
Human   645 YEYDHDANGERVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKYLKHRNI 709

  Fly   643 VRYLGSCSENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAFYSKQILEGLKYLHEQDIVHR 707
            |:||||.||||:.|||||||||||||.||.:||||:|  |.|:.||:||||||||||||..||||
Human   710 VQYLGSVSENGYIKIFMEQVPGGSLSALLRSKWGPMK--EPTIKFYTKQILEGLKYLHENQIVHR 772

  Fly   708 DIKGDNVLVNTYSGVVKISDFGTSKRLARINPMTETFTGTLQYMAPEVIDQGVRGYGPAADIWSF 772
            ||||||||||||||||||||||||||||.:||.||||||||||||||:||||.||||..|||||.
Human   773 DIKGDNVLVNTYSGVVKISDFGTSKRLAGVNPCTETFTGTLQYMAPEIIDQGPRGYGAPADIWSL 837

  Fly   773 GCTNVEMATGKPPFIELGSAHAAMFKVGFYKKHPNIPEELSANAKNFILRCFAISVMDRPSASQL 837
            |||.:||||.||||.|||...|||||||.:|.||.|||.|||.|:.|||.||......|.:.::|
Human   838 GCTIIEMATSKPPFHELGEPQAAMFKVGMFKIHPEIPEALSAEARAFILSCFEPDPHKRATTAEL 902

  Fly   838 LEDPFLQ---------------DKPRKVRPALPINTEFGRSISVPADRFVHKTTPPLSYNTTCNT 887
            |.:.||:               :.||.|..|||...|                  |::.:::   
Human   903 LREGFLRQVNKGKKNRIAFKPSEGPRGVVLALPTQGE------------------PMATSSS--- 946

  Fly   888 PTTPELDITHSS-SVDIDELPSNQFMLERRNSH--GFLLSPEIEPSTPSLRTSISETSETD-GFY 948
                    .|.| |.|.|..|...|...|...|  |.|||...|.|....|...|...:.| |.:
Human   947 --------EHGSVSPDSDAQPDALFERTRAPRHHLGHLLSVPDESSALEDRGLASSPEDRDQGLF 1003

  Fly   949 RLKKDSQRRTTLSKVLALDESKICDIWLKKVDADQNSIAIRKSDLEVLIRGLRDYIMNENEKHLE 1013
            .|:|||:||..|.|:|..:::::.....:.|......:.:....::.:|..|||:|.:...:.:.
Human  1004 LLRKDSERRAILYKILWEEQNQVASNLQECVAQSSEELHLSVGHIKQIIGILRDFIRSPEHRVMA 1068

  Fly  1014 ATINELKQKLNNDAVALDHLHLALYSFQDAVVCVLRYHCIKPHWMFALDNLVKRAVQAAVTIFSP 1078
            .||::||..|:.|:.::..:||.|:.|||||..:||.|.|:||||||:||:::|||||||||..|
Human  1069 TTISKLKVDLDFDSSSISQIHLVLFGFQDAVNKILRNHLIRPHWMFAMDNIIRRAVQAAVTILIP 1133

  Fly  1079 ELGANLADKDLSGNDDESLRTSLMQKGSTESQEKQSLEKVLPTSNTREGVGLTPAES-GGDALSS 1142
            ||.|:.         :.:..|..:.|...|::|                 |..||.. |.:|...
Human  1134 ELRAHF---------EPTCETEGVDKDMDEAEE-----------------GYPPATGPGQEAQPH 1172

  Fly  1143 SMECARILRDIRDNQQKLQRQLLEQQRQSM----RALHNISQELAHIYMGGRKRLRRTINGFNKK 1203
            ....:..|.::|....:|...|:|::|:..    :.|...:|||.|:.:             ..|
Human  1173 QQHLSLQLGELRQETNRLLEHLVEKEREYQNLLRQTLEQKTQELYHLQL-------------KLK 1224

  Fly  1204 CHRMSTSVGGTSGVRPNIAGNPRRQLNKHHFGLHEVDEQLEQWLTQQEIDEFSKTL--ILNEGFT 1266
            .:.::.:..|..|.|                    .|::|..||..|..|  :||:  |:.||:|
Human  1225 SNCITENPAGPYGQR--------------------TDKELIDWLRLQGAD--AKTIEKIVEEGYT 1267

  Fly  1267 FDDFIYNMEKLDLMRLGLRVGIEVRLWKLIIQER 1300
            ..|.:..:.|.||..|.||.|:..|||..:.|.|
Human  1268 LSDILNEITKEDLRYLRLRGGLLCRLWSAVSQYR 1301

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ask1NP_477089.3 DUF4071 74..444 CDD:290020 167/384 (43%)
STKc_ASK 576..843 CDD:270794 190/267 (71%)
S_TKc 590..843 CDD:214567 184/253 (73%)
MAP3K15NP_001001671.3 DUF4071 136..514 CDD:290020 167/384 (43%)
STKc_ASK 643..908 CDD:270794 190/267 (71%)
S_TKc 657..908 CDD:214567 184/253 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113123824
eggNOG 1 0.900 E1_KOG4279
Hieranoid 1 1.000
Homologene 1 1.000 H50401
Inparanoid 1 1.050 973 1.000 Inparanoid score I313
Isobase 1 0.950 0 Normalized mean entropy S2727
OMA 1 1.010
OrthoDB 1 1.010 D122434at33208
OrthoFinder 1 1.000 FOG0001961
OrthoInspector 1 1.000 T609688
orthoMCL 1 0.900 OOG5_130258
Panther 1 1.100 O PTHR11584
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3835
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.