DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ask1 and Map3k5

DIOPT Version :8

Sequence 1:NP_477089.3 Gene:Ask1 / 42366 FlyBaseID:FBgn0014006 Length:1363 Species:Drosophila melanogaster
Sequence 2:NP_001264623.1 Gene:Map3k5 / 365057 RGDID:1306565 Length:1381 Species:Rattus norvegicus

Alignment Length:1347 Identity:559/1348 (41%)
Similarity:782/1348 (58%) Gaps:155/1348 (11%)


  Fly    21 ALEEIKQAVQSAGANFQRVQFERLDFGETNVLETFYNADVAIIDLSILTQQRPLSYHYGVRESFG 85
            ||:.:::|.::.||..:.:.|.:||||||.||:.|||||:|::::|...:|..|.||.||||||.
  Rat   119 ALQSLREACEAVGATLETLHFGKLDFGETTVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRESFS 183

  Fly    86 MKENILTYNDIDSKQTLSLK-LSC-------ANYLFLSYKRNAETN-SCHLTSQPNSGNNSKEPN 141
            |..||:.|.|.:|....||| :.|       .||.|:.|....... .|..:|.........:||
  Rat   184 MANNIILYCDTNSDSLQSLKEIICQKNTVCTGNYTFIPYMVTPHNKVYCCDSSFMKGLTELMQPN 248

  Fly   142 AE---GRV--PTLQWRLKRKLQDVEIQSKAHMREKFLSDMRTARDTYATNGAKLQSILHEMRKRL 201
            .|   |.:  |.:. |..:.|:..:..|..:.||..|:|:|.||:.|  .|.:|.:.|..:|:|:
  Rat   249 FELLLGPICLPLVD-RFVQLLKVAQASSSQYFRESILNDIRKARNLY--TGKELAAELARIRQRV 310

  Fly   202 DDPHVLSGEVVHSFMCSLRDVQDYDAMVRLVNDLKNIPNTRKYVETGNMSFLYAFALNRRNRKGD 266
            |:..||:.::|.:.:.|.||:||||::|:||..|:.:| |.......::.|.|||||||||..||
  Rat   311 DNIEVLTADIVINLLLSYRDIQDYDSIVKLVETLEKLP-TFDLASHHHVKFHYAFALNRRNLPGD 374

  Fly   267 REKALESSLKALEKKENHFPDMLCLCGRIYKDIFVESDYTDATSLAHAIKWYRQSFEVQPNEYAG 331
            |.|||:..:..::.:|....||.||.||||||:|::|::||..|..|...|::::||.:|...:|
  Rat   375 RAKALDIMIPMVQSEEQVASDMYCLVGRIYKDMFLDSNFTDTESRDHGASWFKKAFESEPTLQSG 439

  Fly   332 INLATLLVIEGKEFTNTEELQHIGMTLNNLIGKKGSLSSLSEYWDVATFFEISVLANDYAKAIQA 396
            ||.|.||:..|.:|.::.||:.:|:.|::|:||||:|..|..||:|..|...||||||:.:.|||
  Rat   440 INYAVLLLAAGHQFESSFELRKVGVKLSSLLGKKGNLEKLQSYWEVGFFLGASVLANDHLRVIQA 504

  Fly   397 AECMFKLKPPNWYLKSTIGNISLIHRFRKKPEERQPPIEEQVFQFWMDFFLEATNTEEVKNSIRF 461
            :|.:|:||.|.|||||.:..|.:...|.|...| ||..::::..|||||.:|||.|:  ...:||
  Rat   505 SEKLFRLKTPAWYLKSIVETILIYKHFVKLTTE-QPTAKQELVDFWMDFLVEATKTD--VTVVRF 566

  Fly   462 PILILEPQKIYMPSYVTINMDADEKSIQIVNICLAHAKNACKKIHDFLFVASKIKSVSLYKRDDR 526
            |:|||||.|||.|||::||.:.:||:|.|.:: |...|   |.||::.|.||.::.||:.|.::|
  Rat   567 PVLILEPTKIYQPSYLSINNEVEEKTISIWHV-LPDDK---KGIHEWNFNASSVRGVSISKFEER 627

  Fly   527 CAYLYVHHNSDDFQIYFPSTERRQKFYDMILEMTADQVVFVNLSN-DDANIEYEYDYDEQNRKMV 590
            |.:|||.||||||||||.:....::|::|:..:|.::.......: :..::||:|::||...::|
  Rat   628 CCFLYVLHNSDDFQIYFCTELHCKRFFEMVNTITEEKGRGAEEGDCEGDSLEYDYEHDENGDRVV 692

  Fly   591 LGKGTYGTVYAARDKQTQVRIAIKEVPEKNSQDVQPLHEEIKLHSQLRHRNIVRYLGSCSENGFF 655
            |||||||.|||.||...||||||||:||::|:..|||||||.||..|:|:|||:||||.|||||.
  Rat   693 LGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKHLKHKNIVQYLGSFSENGFI 757

  Fly   656 KIFMEQVPGGSLSDLLETKWGPLKDNESTMAFYSKQILEGLKYLHEQDIVHRDIKGDNVLVNTYS 720
            |||||||||||||.||.:|||||||||.|:.||:|||||||||||:..||||||||||||:||||
  Rat   758 KIFMEQVPGGSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYS 822

  Fly   721 GVVKISDFGTSKRLARINPMTETFTGTLQYMAPEVIDQGVRGYGPAADIWSFGCTNVEMATGKPP 785
            ||:||||||||||||.|||.||||||||||||||:||:|.||||.||||||.|||.:||||||||
  Rat   823 GVLKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPP 887

  Fly   786 FIELGSAHAAMFKVGFYKKHPNIPEELSANAKNFILRCFAISVMDRPSASQLLEDPFLQ--DKPR 848
            |.|||...|||||||.:|.||.|||.:||.||.|||:||......|..|:.||.|.||:  .|.:
  Rat   888 FYELGEPQAAMFKVGMFKVHPEIPESMSAEAKAFILKCFEPDPDKRACANDLLVDEFLKVSSKKK 952

  Fly   849 KVRPALP----INTEFGRSISVPADRFVHKTTPPLSYNTTCNTPTTPELDITHSSSVDIDELPSN 909
            |.:|.|.    ...|:.||||:|....|..|:....|.:.  :|.|              ||.::
  Rat   953 KTQPKLSGMWLHGEEYLRSISLPVPVLVEDTSSSSEYGSV--SPDT--------------ELKAD 1001

  Fly   910 QFMLE-RRNSHG----------FLLSPE------IEPSTPSLRTSISETSETDGFYRLKKDSQRR 957
            .|..: |..|.|          ||..|:      ..|.:|..:.|        ||:.|:|||:||
  Rat  1002 PFSFKTRAKSCGEKDGKGIRTLFLGIPDENFEDHSAPPSPEEKDS--------GFFMLRKDSERR 1058

  Fly   958 TTLSKVLALDESKICDIWLKKVDADQNSIAIRKSDLEVLIRGLRDYIMNENEKHLEATINELKQK 1022
            .||.::|..|:.|:....::.:........::...:..||..||:::.:.:.|.:..|::.||.:
  Rat  1059 ATLHRILTEDQDKVVRNLMESLAQGPEEPKLKWEHITTLISSLREFVRSTDRKIIATTLSRLKLE 1123

  Fly  1023 LNNDAVALDHLHLALYSFQDAVVCVLRYHCIKPHWMFALDNLVKRAVQAAVTIFSPEL------- 1080
            |:.|:..:..:.:.|:.|||||..|||.|.||||||||||:::::|||.|:||..|||       
  Rat  1124 LDFDSHGISQVQVVLFGFQDAVNKVLRNHNIKPHWMFALDSIIRKAVQTAITILVPELRPHFSLA 1188

  Fly  1081 -GANLAD-KDLSGNDDESLRTSLMQKGSTESQEKQSLEKVLPTSNTREGVGLTPAESGGDALSSS 1143
             .::.|| :||..:|:..           ||...|:..:..|.:..      ..|.||...|||:
  Rat  1189 SESDTADPEDLDVDDEHE-----------ESPSNQTARRPQPVAED------AVATSGVSTLSST 1236

  Fly  1144 --------------------MECARILRDIRDNQQKLQRQLLEQQRQSMRALHNISQELAHIYMG 1188
                                ||..|:|.::...:::|| .||.|      |:....||:.|:.: 
  Rat  1237 VSHDSQNAHRSLNVQLGRMKMETNRLLEELVRKEKELQ-ALLHQ------AIEEKDQEIKHLRL- 1293

  Fly  1189 GRKRLRRTINGFNKKCHRMSTSVGGTSGVRPNIAGNPRRQLNKHHFGLHEVDEQLEQWLTQQEID 1253
                          |...:.|            .|.|...||..  |....|.:|..||.:...|
  Rat  1294 --------------KSQPIDT------------PGFPVCHLNAP--GTAIEDSELTGWLRENGAD 1330

  Fly  1254 EFSKTLILNEGFTFDDFIYNMEKLDLMRLGLRVGIEVRLWKLIIQER 1300
            |.:.:..|.|.:|..|.:|.:.:.||..|.||.|:...|||.||..|
  Rat  1331 EDTISRFLAEDYTLVDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFR 1377

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ask1NP_477089.3 DUF4071 74..444 CDD:290020 151/384 (39%)
STKc_ASK 576..843 CDD:270794 193/267 (72%)
S_TKc 590..843 CDD:214567 188/253 (74%)
Map3k5NP_001264623.1 DUF4071 172..551 CDD:290020 151/384 (39%)
STKc_ASK 678..945 CDD:270794 193/267 (72%)
S_TKc 692..945 CDD:214567 188/253 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113127917
eggNOG 1 0.900 E1_KOG4279
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D122434at33208
OrthoFinder 1 1.000 FOG0001961
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130258
Panther 1 1.100 O PTHR11584
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.