DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ask1 and byr2

DIOPT Version :8

Sequence 1:NP_477089.3 Gene:Ask1 / 42366 FlyBaseID:FBgn0014006 Length:1363 Species:Drosophila melanogaster
Sequence 2:NP_595714.2 Gene:byr2 / 2540612 PomBaseID:SPBC1D7.05 Length:659 Species:Schizosaccharomyces pombe

Alignment Length:707 Identity:185/708 (26%)
Similarity:304/708 (43%) Gaps:159/708 (22%)


  Fly   235 LKNIPNTRKYVETGNMSFLYAFALNRRNRKGDREKALESSLKA---LEKKE--NHFPDMLCL--- 291
            ||:| ...||:|..:.:.:....||.......::..:|::.|.   |::::  ..||....|   
pombe    13 LKSI-GLEKYIEQFSQNNIEGRHLNHLTLPLLKDLGIENTAKGKQFLKQRDYLREFPRPCILRFI 76

  Fly   292 -CGRIYKDIFVESDYTDATSLAHAIKWY----RQSFEVQPNEYAGINLAT--------------- 336
             |....:.:....||  ..:||.|:|.:    ...|.|..::.:.|.|.|               
pombe    77 ACNGQTRAVQSRGDY--QKTLAIALKKFSLEDASKFIVCVSQSSRIKLITEEEFKQICFNSSSPE 139

  Fly   337 --LLVIEGKE-----FTNTEELQHIGMTLNNLIGKKGSLS-SLSEYWDVATFFEISVLANDYAKA 393
              .|:|..||     |.:......|.:.....:..:.||| .||.....:| .:.||.:|: ||.
pombe   140 RDRLIIVPKEKPCPSFEDLRRSWEIELAQPAALSSQSSLSPKLSSVLPTST-QKRSVRSNN-AKP 202

  Fly   394 IQAAECMFKLKPPNWYLKSTIG---------------------NISL-------IHRF------- 423
            .::.:     :||:..:.|.|.                     |:|:       :..|       
pombe   203 FESYQ-----RPPSELINSRISDFFPDHQPKLLEKTISNSLRRNLSIRTSQGHNLGNFGQEILPR 262

  Fly   424 ---RKKPEERQPPIEEQVFQFWMDFFLEATNTEEVKNSIRF------PILILEPQKIYMPSYVTI 479
               |.:|.|...|:..          |..:..|:|....|.      |:.:...|:|..|..:  
pombe   263 SSRRARPSELVCPLSS----------LRISVAEDVNRLPRIDRGFDPPLTVSSTQRISRPPSL-- 315

  Fly   480 NMDADEKSIQIVNICLAHAKNACKKIHDFLFVASKIKSVSLYKRDDRCAYLYVHHNSDDFQIYFP 544
                 :|||.:|.:...:..|..:|       :||....|.....:.....:...:|..| |..|
pombe   316 -----QKSITMVGVEPLYQSNGNEK-------SSKYNVFSESAHGNHQVLSFSPGSSPSF-IEQP 367

  Fly   545 STERRQKFYDMILEMTADQVVFVNLSNDDANIEYEYDYDEQNRKMV----LGKGTYGTVYAARDK 605
            |                 .:...:.:::|.| ..|.|.|:|:.|.:    :|.|::|.||...:.
pombe   368 S-----------------PISPTSTTSEDTN-TLEEDTDDQSIKWIRGALIGSGSFGQVYLGMNA 414

  Fly   606 QTQVRIAIKEV--------PEKNSQDVQPLHEEIKLHSQLRHRNIVRYLGSCSENGFFKIFMEQV 662
            .:...:|:|:|        .:::::.:..|..||.|..:|.|.:||:||||...:....||:|.|
pombe   415 SSGELMAVKQVILDSVSESKDRHAKLLDALAGEIALLQELSHEHIVQYLGSNLNSDHLNIFLEYV 479

  Fly   663 PGGSLSDLLETKWGPLKDNESTMAFYSKQILEGLKYLHEQDIVHRDIKGDNVLVNTYSGVVKISD 727
            ||||::.|| |.:|..:  |:.:..:.||.|:||:|||.:.||||||||.|:||:. .|.:||||
pombe   480 PGGSVAGLL-TMYGSFE--ETLVKNFIKQTLKGLEYLHSRGIVHRDIKGANILVDN-KGKIKISD 540

  Fly   728 FGTSKRLARINPMTET------FTGTLQYMAPEVIDQGVRGYGPAADIWSFGCTNVEMATGKPPF 786
            ||.||:|...:..|:|      |.|:..:|||||:.|.:  :....||||.||..:||.|.|.|:
pombe   541 FGISKKLELNSTSTKTGGARPSFQGSSFWMAPEVVKQTM--HTEKTDIWSLGCLVIEMLTSKHPY 603

  Fly   787 IELGSAHAAMFKVGFYKKHPNIPEELSANAKNFILRCFAISVMDRPSASQLLEDPFL 843
            ....... |:|::| ....|..|..:|::|.:|:.:.|||....||:||:||..||:
pombe   604 PNCDQMQ-AIFRIG-ENILPEFPSNISSSAIDFLEKTFAIDCNLRPTASELLSHPFV 658

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ask1NP_477089.3 DUF4071 74..444 CDD:290020 54/283 (19%)
STKc_ASK 576..843 CDD:270794 107/285 (38%)
S_TKc 590..843 CDD:214567 102/271 (38%)
byr2NP_595714.2 PKc_like 393..658 CDD:304357 103/273 (38%)
Pkinase 394..658 CDD:278497 102/272 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R6807
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.