DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ask1 and map3k15

DIOPT Version :8

Sequence 1:NP_477089.3 Gene:Ask1 / 42366 FlyBaseID:FBgn0014006 Length:1363 Species:Drosophila melanogaster
Sequence 2:XP_021326014.1 Gene:map3k15 / 100334289 ZFINID:ZDB-GENE-091204-246 Length:1361 Species:Danio rerio

Alignment Length:1365 Identity:574/1366 (42%)
Similarity:787/1366 (58%) Gaps:169/1366 (12%)


  Fly    21 ALEEIKQAVQSAGANFQRVQFERLDFGETNVLETFYNADVAIIDLSILTQQRPLSYHYGVRESFG 85
            ||:.:::|..:..|....|.|.|||||||.||:|||:||:|::|:|.:.:|..|.||.||||||.
Zfish    65 ALQCLQRACDAESAILTTVTFGRLDFGETTVLDTFYDADIAVVDMSDVFRQPSLFYHLGVRESFD 129

  Fly    86 MKENILTYNDIDSKQTLSL----------------------------------KLSCANYLFLSY 116
            |..|::.|:|:|.....||                                  |.|..||.|:.|
Zfish   130 MANNVILYHDMDPDTAQSLKDMVAQKNTAARPVKIGFPWVQLPPEYRGSGLRNKASSGNYYFIPY 194

  Fly   117 --KRNAETNSCHLTSQPNSGNNSKEPNAEGR-----VPTLQWRLKRKLQDVEIQSKAHMREKFLS 174
              ..|.|...|...:| ...:...:||.:..     ||.:. |....|:|:.:.|.|..::..|:
Zfish   195 LMTPNNEYLCCENVAQ-RRASEYMQPNWDNLLGPLCVPLVD-RFVSLLKDIHVTSCASYKDALLN 257

  Fly   175 DMRTARDTYATNGAKLQSILHEMRKRLDDPHVLSGEVVHSFMCSLRDVQDYDAMVRLVNDLKNIP 239
            |:|.|||.|  .|.:|...|..::.|:|:..||:.::|.:.:.|.||:|||||||:||..::.:|
Zfish   258 DIRKARDKY--QGEELAKELSRIKLRIDNTEVLTQDIVMNLLFSYRDIQDYDAMVKLVQTIEMLP 320

  Fly   240 NTRKYVETGNMSFLYAFALNRRNRKGDREKALESSLKALEKKENHFPDMLCLCGRIYKDIFVESD 304
             |........:.|.|||||||||..||||:||...|:.|:..|:..|||.|||||||||||::||
Zfish   321 -TCDLANQPMIQFHYAFALNRRNSPGDREQALRVMLQVLQSCEHPAPDMFCLCGRIYKDIFLDSD 384

  Fly   305 YTDATSLAHAIKWYRQSFEVQPNEYAGINLATLLVIEGKEFTNTEELQHIGMTLNNLIGKKGSLS 369
            ..|..:..:||:|||:.||:||..|:|||||.||::.|::|..:.||:.||:.||:|:|:||||.
Zfish   385 CKDTKNRDNAIQWYRKGFELQPTLYSGINLAVLLIVAGQQFETSIELRKIGVRLNSLLGRKGSLE 449

  Fly   370 SLSEYWDVATFFEISVLANDYAKAIQAAECMFKLKPPNWYLKSTIGNISLIHRFRKKPEERQPPI 434
            .::.||||..||.:|:||||..||:||||.:||||||.|||:|.:.|:.||..|:|:..|..|  
Zfish   450 KMNNYWDVGQFFTVSMLANDIPKAVQAAEKLFKLKPPIWYLRSVVQNLQLIQHFKKQNTEHSP-- 512

  Fly   435 EEQVFQFWMDFFLEATNTEEVKNSIRFPILILEPQKIYMPSYVTINMDADEKSIQIVNICLAHAK 499
            :.:...||||..:||  |:...|.:|||:|||||.|:|.||||:||.:|:||::.|.::..|..|
Zfish   513 QRERLNFWMDIIVEA--TQGTTNGLRFPVLILEPTKVYQPSYVSINSEAEEKNVSIWHVSPAETK 575

  Fly   500 NACKKIHDFLFVASKIKSVSLYKRDDRCAYLYVHHNSDDFQIYFPSTERRQKFYDMILEMTAD-- 562
            .    ||::.|.||.||.:|:.|.|:||.:||||.|||||||||.:.::..:|..|:.|:..|  
Zfish   576 G----IHEWNFTASSIKGISISKFDERCCFLYVHDNSDDFQIYFSTEDQCGRFCSMVKELITDGS 636

  Fly   563 -QVVFVNLSNDDANIEYEYDYDEQNRKMVLGKGTYGTVYAARDKQTQVRIAIKEVPEKNSQDVQP 626
             ..|.:....|...:||||||:|...::|||:||||.|||.||...||||||||:||::|:..||
Zfish   637 GNAVELEGEGDGDTLEYEYDYNENGDRVVLGRGTYGVVYAGRDLSNQVRIAIKEIPERDSRYSQP 701

  Fly   627 LHEEIKLHSQLRHRNIVRYLGSCSENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAFYSKQ 691
            |||||.||..|:|||||:||||.||:|:.|||||||||||||.||.:||||||  |:|:.||::|
Zfish   702 LHEEIALHKYLKHRNIVQYLGSVSEDGYIKIFMEQVPGGSLSALLRSKWGPLK--EATIIFYTRQ 764

  Fly   692 ILEGLKYLHEQDIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLARINPMTETFTGTLQYMAPEVI 756
            ||||::||||..|||||||||||||||||||:||||||||||||.:||.||||||||||||||:|
Zfish   765 ILEGIRYLHENQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGVNPCTETFTGTLQYMAPEII 829

  Fly   757 DQGVRGYGPAADIWSFGCTNVEMATGKPPFIELGSAHAAMFKVGFYKKHPNIPEELSANAKNFIL 821
            |:|.||||..|||||.|||.:|||||||||.|||...|||||||.:|.||.|||.||:.||:|||
Zfish   830 DKGPRGYGAPADIWSLGCTIIEMATGKPPFHELGEPQAAMFKVGMFKIHPEIPESLSSEAKSFIL 894

  Fly   822 RCFAISVMDRPSASQLLEDPFLQD----KPRKVRPALPINTEFGRSISVPADRFVHKT----TPP 878
            ..|......|..|..||:||||:.    |..|:.....:..::.||:|:|.......|    :.|
Zfish   895 SSFEPDPNKRAMAGDLLKDPFLRQNIKGKKNKIAFKPSVWQDYIRSVSLPVQLQTEATGSSSSEP 959

  Fly   879 LSYNTTCNTPTTPELDI-----THSSSVDIDELPSNQFMLERRNSHGFLLSPEIEPSTPSLRTSI 938
            .|.:..|::    :.|:     ..|||.::.:.||:.          ||..|:..|:.....:..
Zfish   960 GSVSPDCDS----KQDVFFEKKKRSSSENLIKPPSST----------FLSVPDESPTAEDRSSPA 1010

  Fly   939 SETSETDGFYRLKKDSQRRTTLSKVLALDESKICDIWLKKVDADQNSIAIRKSDLEVLIRGLRDY 1003
            |..:...|.:.|||||:||..|.|||..|:.|:....::.....|..:.:....::.:|..|||:
Zfish  1011 SSENSDSGLFLLKKDSERRAILYKVLNEDQDKVTSNLMENHIQGQEELKLSVDHIKQIICILRDF 1075

  Fly  1004 IMNENEKHLEATINELKQKLNNDAVALDHLHLALYSFQDAVVCVLRYHCIKPHWMFALDNLVKRA 1068
            |.....:.:..||::||..|:.|:.:::.:.|.|:.|||:|..|||.|.||||||||:||:::||
Zfish  1076 IRCPERRVMATTISKLKLDLDFDSTSINQIQLVLFGFQDSVNKVLRNHHIKPHWMFAMDNIIRRA 1140

  Fly  1069 VQAAVTIFSPELGANL--------ADKDLSGNDDES----------------LRTSLMQKGSTES 1109
            |||||||..|||..:.        ||||....|:|.                |.:.:....|..|
Zfish  1141 VQAAVTILIPELQTHFGPASESEGADKDADEVDEEDDADFGSVARTTQEDQVLTSGVSTLSSVIS 1205

  Fly  1110 QEKQSLEKVLPTSNTREGVGLTPAESGGDALSSSMECARILRDI----RDNQQKLQRQLLEQQRQ 1170
            .:.|.|:..|                |........|..|:|.::    |:.||.| ||.|:|:  
Zfish  1206 HDAQRLQHPL----------------GAQLGRLKQETCRLLEELVQKEREYQQVL-RQTLQQR-- 1251

  Fly  1171 SMRALHNISQELAHIYMGGRKRLRRTINGFNKKCHRMSTSVGGTSGVRPNIAGNPRRQLNKHHFG 1235
                :|:|  ||.        |:|:                      :|..|..|......|...
Zfish  1252 ----VHDI--ELI--------RIRQ----------------------QPAAAEMPTTPSVFHVTA 1280

  Fly  1236 LHEVDEQLEQWLTQQEIDEFSKTLILNEGFTFDDFIYNMEKLDLMRLGLRVGIEVRLWKLIIQER 1300
            ..|.|::|..||.:|..|..:....:.|.::..|.:.::.|.||..|.||.|:..|:||.|.|.|
Zfish  1281 QPEPDKKLTDWLKEQGADSETIDKFVAEDYSLSDVLCDITKEDLRCLRLRGGMLCRIWKAIQQHR 1345

  Fly  1301  1300
            Zfish  1346  1345

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ask1NP_477089.3 DUF4071 74..444 CDD:290020 168/411 (41%)
STKc_ASK 576..843 CDD:270794 188/267 (70%)
S_TKc 590..843 CDD:214567 181/253 (72%)
map3k15XP_021326014.1 DUF4071 118..522 CDD:315861 168/411 (41%)
STKc_ASK 651..916 CDD:270794 188/267 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113123002
eggNOG 1 0.900 E1_KOG4279
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H50401
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D122434at33208
OrthoFinder 1 1.000 FOG0001961
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130258
Panther 1 1.100 O PTHR11584
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.