DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ask1 and map3k15

DIOPT Version :8

Sequence 1:NP_477089.3 Gene:Ask1 / 42366 FlyBaseID:FBgn0014006 Length:1363 Species:Drosophila melanogaster
Sequence 2:NP_001136137.1 Gene:map3k15 / 100216453 XenbaseID:XB-GENE-1002755 Length:162 Species:Xenopus tropicalis

Alignment Length:176 Identity:40/177 (23%)
Similarity:65/177 (37%) Gaps:40/177 (23%)


  Fly  1135 SGGDALSSSMECARILRDIRDNQQKLQRQLLEQQRQSMRALHNISQELAHIYMGGRKRLRRTING 1199
            ||...|||.     :..:.:..|..||...|.|:      .:.:.:||.......:..|::.:..
 Frog     7 SGVSTLSSV-----VSHETQGQQTNLQLGKLRQE------TNRLMEELVLKEREYQLILKQCLEQ 60

  Fly  1200 FNKKCHRM----------STSVGGTSGVRPNIAGNPRRQLNKHHFGLHEVDEQLEQWLTQQEIDE 1254
            .|...|.:          ||.|...|..||                   .|::|..||.:...|:
 Frog    61 RNHDLHLLQIKSSPIDIPSTPVPYVSHERP-------------------TDQELVNWLRELGADD 106

  Fly  1255 FSKTLILNEGFTFDDFIYNMEKLDLMRLGLRVGIEVRLWKLIIQER 1300
            ......:.|.:|..:.::::.|.||..|.||.|...|:||.|.:.|
 Frog   107 DVVNQFVEEEYTLYNVLHDITKDDLKSLRLRGGELCRIWKAITKYR 152

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ask1NP_477089.3 DUF4071 74..444 CDD:290020
STKc_ASK 576..843 CDD:270794
S_TKc 590..843 CDD:214567
map3k15NP_001136137.1 SAM_superfamily 90..152 CDD:301707 19/81 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113123694
eggNOG 1 0.900 E1_KOG4279
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.800

Return to query results.
Submit another query.