DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6300 and acsl1a

Sequence 1:NP_650828.1 Gene:CG6300 FlyBaseID:FBgn0038730 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001027007.1 Gene:acsl1a ZFINID:ZDB-GENE-050809-115 Length:697 Species:Danio rerio

Alignment Length:558 Identity:129/559 (23%)
Similarity:196/559 (35%) Gaps:151/559 (27%)


  Fly    10 DNDQKIWSGEPVVKYFDPDLSIGEIIFHEMR---RHPQLTAQISATEGTVLTRGELLANAMRLAS 71
            |||..      :..|:...|::.|.....:|   ..|.|.::.:......|:..|:...|....|
Zfish    77 DNDTH------MTYYYKDALTLYEFFLRGLRVPNNGPCLGSRKAGQPYKWLSYKEVADRAEFAGS 135

  Fly    72 YMRSLGLLQS--DIVGIIGRNTTHMLAVAYACFFNGIAFHSLNITYDRDTIEKIYKVTRPSI--I 132
            .:...|..||  ..:||..:|.........||:...:....|..|...:.|.  |.:.:.||  |
Zfish   136 ALLHRGHSQSGDKYIGIFAQNRPEWTISELACYTYSLVAVPLYDTLGTEAIS--YVIDKASITTI 198

  Fly   133 FCD-GDEFEKVRSATAELDVKIVTMRNHPLDSIKIDEVVATPIEENFQPAKLE-----------K 185
            .|| .|:        |.|.:..|:.|.|.:.:|.|.|...:.:....|...::           |
Zfish   199 ICDIADK--------ARLILDCVSGRKHSVTTIVIMESFDSELTAQAQNCGIDIISLKELEAIGK 255

  Fly   186 GNDQT--------LAILC-SSGTTGTPKAVTITN-------SRHILAGNYH--LTTADVQYSHNT 232
            .|.:|        ||::| :|||||.||...:|:       |..|.....|  |...|:..|:..
Zfish   256 ANHKTPIPPKPEDLALICFTSGTTGNPKGAMLTHGNVVSNCSAFIKITEVHCMLNQTDIHISYLP 320

  Fly   233 LDWITGLLTTITSGVF-----------STTRIIADNAFD---------PAFALRIIEEYKVTWTI 277
            |   ..:...:..||.           ...|::.|:..:         |....|:.:  |:....
Zfish   321 L---AHMFERVVEGVLLCHGAKIGYFQGDIRLLMDDLKNLKPTIFPVVPRLLNRMFD--KIFGQA 380

  Fly   278 QPPSSMALMINCPDFETCDMSSLRCYMFGGSRAALEVQKGI---------------------RSR 321
            ..|....|:    ||.|             ||...|::.|:                     |.|
Zfish   381 NTPLKRWLL----DFAT-------------SRKEAELKSGVVRKDSMWDKLIFSKVQASLGGRVR 428

  Fly   322 L--------SHDCLQFV-----------YGFTELGAMATINCHFDEKTGSVG--------QLVNG 359
            |        |...|.|:           ||.||..|..|::...|...|.||        :||:.
Zfish   429 LMITGAAPVSPTVLTFLRAALGCQFYEGYGQTECTAGCTMSLPGDWTAGHVGAPLPCNFVKLVDV 493

  Fly   360 LKMKIINDDGESLGPDEIGEVCIMNNQHWSGYYGNEVETRNMRDSLGWYHSGDLGYMDRDGFLYI 424
            .:|.....:||       ||||:.....:.||..:..:|....|..||.|:||:|....:|.|.|
Zfish   494 AEMNYFAANGE-------GEVCVKGPNVFQGYLKDPEQTSGAVDKAGWLHTGDIGKWLPNGTLKI 551

  Fly   425 MDRKKEMLKYQNIMYY-PNDIESVISEMPQVAEVCVFG 461
            :||||.:.|.....|. |..||::......||:|.|.|
Zfish   552 IDRKKHIFKLAQGEYIAPEKIENIYIRSDPVAQVFVHG 589

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6300NP_650828.1 CaiC 26..523 CDD:223395 125/543 (23%)
AFD_class_I 47..522 CDD:302604 120/519 (23%)
acsl1aNP_001027007.1 PLN02736 88..695 CDD:178337 125/542 (23%)
LC-FACS_euk 116..692 CDD:213293 120/514 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C91678241
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.