DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6300 and CG18586

Sequence 1:NP_650828.1 Gene:CG6300 FlyBaseID:FBgn0038730 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_647993.2 Gene:CG18586 FlyBaseID:FBgn0035642 Length:545 Species:Drosophila melanogaster

Alignment Length:530 Identity:298/531 (56%)
Similarity:398/531 (75%) Gaps:0/531 (0%)


  Fly     8 SYDNDQKIWSGEPVVKYFDPDLSIGEIIFHEMRRHPQLTAQISATEGTVLTRGELLANAMRLASY 72
            :||:..|||||......|.|:||||||||.:|..:|:|.||||.||..||||.:|..||||:|||
  Fly    16 TYDDKLKIWSGREAPSLFSPNLSIGEIIFGDMVNNPKLIAQISITEDIVLTREDLHMNAMRVASY 80

  Fly    73 MRSLGLLQSDIVGIIGRNTTHMLAVAYACFFNGIAFHSLNITYDRDTIEKIYKVTRPSIIFCDGD 137
            ||::||.|:||||::||:|||..||||||||||...|:|:..|:...|.|::.:|:|.:||||||
  Fly    81 MRNMGLGQTDIVGVMGRHTTHQSAVAYACFFNGTPLHALHNAYEEACIAKLFGITKPRLIFCDGD 145

  Fly   138 EFEKVRSATAELDVKIVTMRNHPLDSIKIDEVVATPIEENFQPAKLEKGNDQTLAILCSSGTTGT 202
            |:|||:|||.:|.|.||||||||..|::|.:|:.||:.:||||.:|:.|.|.|||||.||||:|.
  Fly   146 EYEKVKSATKDLQVTIVTMRNHPRGSVRIQDVLTTPVMQNFQPLRLKDGIDHTLAILSSSGTSGF 210

  Fly   203 PKAVTITNSRHILAGNYHLTTADVQYSHNTLDWITGLLTTITSGVFSTTRIIADNAFDPAFALRI 267
            ||||||:||..|:.....:..:::||:.:||||.:||...|||||||||.||||..|||....|.
  Fly   211 PKAVTISNSHKIIVDYMAINNSNIQYTSSTLDWCSGLSMAITSGVFSTTSIIADCDFDPGLFCRA 275

  Fly   268 IEEYKVTWTIQPPSSMALMINCPDFETCDMSSLRCYMFGGSRAALEVQKGIRSRLSHDCLQFVYG 332
            |.:|:::..:...|.:|:..|||:||:.|:|||...:||||..:||||:.:|||||||||.|.||
  Fly   276 IGKYRISMVLLSSSYLAIFANCPEFESADLSSLNYVIFGGSSCSLEVQRKVRSRLSHDCLNFCYG 340

  Fly   333 FTELGAMATINCHFDEKTGSVGQLVNGLKMKIINDDGESLGPDEIGEVCIMNNQHWSGYYGNEVE 397
            .|||.:..::|.:||||..|||:.:.|:|:|:|::.||:..|:.:||:|..|:|.|:|||.|..|
  Fly   341 LTELNSAGSVNLNFDEKPNSVGRAIRGIKIKVIDEQGEAQEPNVVGEICFHNSQKWAGYYKNPDE 405

  Fly   398 TRNMRDSLGWYHSGDLGYMDRDGFLYIMDRKKEMLKYQNIMYYPNDIESVISEMPQVAEVCVFGI 462
            ||.::||..|.|:|||||:|:||:|:::||.|:|||||||||||::||:||:|||.|.|.|||||
  Fly   406 TRQIQDSENWIHTGDLGYVDKDGYLFVIDRLKDMLKYQNIMYYPSEIENVIAEMPNVLEACVFGI 470

  Fly   463 WSNIFGDEAAAAVVKKLGSELEAQDVVDYVRSRTDSKYKQLNGGAVIVDDLQRSANGKTNRMANK 527
            |..:.||||||::|||.|::|||||||:|||.|..:|:|||||||:|||.:.||.|.||||.|.|
  Fly   471 WDPVNGDEAAASLVKKPGTQLEAQDVVEYVRKRITAKFKQLNGGALIVDQIVRSGNRKTNRSAVK 535

  Fly   528 AYFLHLKNRS 537
            .:||...|.:
  Fly   536 EHFLKNYNNN 545

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6300NP_650828.1 CaiC 26..523 CDD:223395 284/497 (57%)
AFD_class_I 47..522 CDD:302604 271/475 (57%)
CG18586NP_647993.2 CaiC 35..541 CDD:223395 289/506 (57%)
AFD_class_I 55..530 CDD:302604 271/475 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130772067
eggNOG 1 0.900 E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D683933at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24096
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.