DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6300 and ACSM4

Sequence 1:NP_650828.1 Gene:CG6300 FlyBaseID:FBgn0038730 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001073923.1 Gene:ACSM4 HGNCID:32016 Length:580 Species:Homo sapiens

Alignment Length:505 Identity:115/506 (23%)
Similarity:203/506 (40%) Gaps:71/506 (14%)


  Fly    60 GELLANAMRLASYMRSLGLLQSDIVGIIGRNTTHMLAVAYACFFNGIAF--HSLNITYDRDTIEK 122
            |.|...|..:.:  :..||.:.|.:.:|.........|..||...||.|  .::.:| .:|.:.:
Human    95 GSLSRKAANVLT--KPCGLQRGDRLAVILPRIPEWWLVNVACIRTGIIFMPGTIQLT-AKDILYR 156

  Fly   123 IYKVTRPSIIFCDGDEFEKVRSATAE---LDVKIVTMRNHPLDSIKIDEVVATPIEENFQPAKLE 184
            : :.::...|....:....|.|...|   |..|::.........:...|:.....||:   :.:|
Human   157 L-RASKAKCIVASEEVAPAVESIVLECPDLKTKLLVSPQSWNGWLSFQELFQFASEEH---SCVE 217

  Fly   185 KGNDQTLAILCSSGTTGTPKAVTITNSR----HILAGNY--HLTTADVQYSHNTLDWITGLLTTI 243
            .|:.:.:.|..:|||||.||....:.|.    ..|.|.|  .|.::|:.::.:...|:...:.::
Human   218 TGSQEPMTIYFTSGTTGFPKMAQHSQSSLGIGFTLCGRYWLDLKSSDIIWNMSDTGWVKAAIGSV 282

  Fly   244 TSGVFSTTRIIADN--AFDPAFALRIIEEYKVTWTIQPPSSMALMINCPDFETCDMSSLRCYMFG 306
            .|.......:....  .||....|..:..|.:|....||:...:::. .|.:.....|||..:.|
Human   283 FSSWLCGACVFVHRMAQFDTDTFLDTLTTYPITTLCSPPTVYRMLVQ-KDLKRYKFKSLRHCLTG 346

  Fly   307 GS------------RAALEVQKGIRSRLSHDCLQFVYGFTELGAMATINCHFDEKTGSVGQLVNG 359
            |.            :..||:.:|             ||.||:|.:.......:.|.||:|:.:..
Human   347 GEPLNPEVLEQWRVQTGLELYEG-------------YGQTEVGMICANQKGQEIKPGSMGKGMLP 398

  Fly   360 LKMKIINDDGESLGPDEIGEVCIMNNQ-----HWSGYYGNEVET-RNMRDSLGWYHSGDLGYMDR 418
            ..::||:::|..|.|.:.||:.:....     .:|.|..|..:| ..:|..  :|.:||.|.||.
Human   399 YDVQIIDENGNVLPPGKEGEIALRLKPTRPFCFFSKYVDNPQKTAATIRGD--FYVTGDRGVMDS 461

  Fly   419 DGFLYIMDRKKEMLKYQNIMYYPNDIESVISEMPQVAEVCVFGIWSNIFGDEAAAAVV------- 476
            ||:.:.:.|..:::........|.::||.:.|.|.|.|..|......|.|:...|.||       
Human   462 DGYFWFVGRADDVIISSGYRIGPFEVESALIEHPAVVESAVVSSPDQIRGEVVKAFVVLAAPFKS 526

  Fly   477 ---KKLGSELEAQDVVDYVRSRTDSKYKQLNGGAVIVDDLQRSANGKTNR 523
               :||..||:     |:|:..| :.||... ....|.:|.::..||..|
Human   527 YNPEKLTLELQ-----DHVKKST-APYKYPR-KVEFVQELPKTITGKIKR 569

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6300NP_650828.1 CaiC 26..523 CDD:223395 114/504 (23%)
AFD_class_I 47..522 CDD:302604 114/503 (23%)
ACSM4NP_001073923.1 MACS_euk 48..577 CDD:213294 115/506 (23%)
Acs 49..580 CDD:223442 115/506 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.