DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6300 and CG18155

Sequence 1:NP_650828.1 Gene:CG6300 FlyBaseID:FBgn0038730 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster

Alignment Length:608 Identity:115/609 (19%)
Similarity:208/609 (34%) Gaps:175/609 (29%)


  Fly     7 NSYDNDQK------------IWSGEPVVKYFDPDLSIGEIIFHEM-RRHPQLTAQISATEGTVLT 58
            :|:|.:::            ::..|..||    |:: ||..:.:: ....:|..|||...|    
  Fly    35 HSFDEEERSNVVVPTFKKAMLYPDEIAVK----DIN-GEYTYFQLYMAAKRLGIQISNICG---- 90

  Fly    59 RGELLANAMRLASYMRSLGLLQSDIVGIIGRNTTHMLAVAYACFFNGIAFHSLNITYDRDTIEKI 123
             |..|:|...|.|                  |....:|:.::|:.:|.....|......|.:::.
  Fly    91 -GAALSNVTYLCS------------------NNALWIAIQWSCWISGQVAVPLESGQAIDQLQRQ 136

  Fly   124 YKVTRPSIIFCDGDEFEK--------VRSATAELDVKIV-TMRNHPLDSIKIDEVVATP---IEE 176
            ....:..::... .|||.        |:|||..||...: |..:....|:...::||..   :.|
  Fly   137 ASNCKTKLLIAT-KEFESLAQELSQGVKSATIILDHSFLPTAESVSSTSMYAKQLVAIQGVIVTE 200

  Fly   177 NFQPAKLEKGND----QTLAILCSSGTTGTPKAVTITNSRHI------LAGNYHLTTADVQ---Y 228
            |..|      ||    ....::.:.....:||.|.:|: |:|      |.|.:||...|..   .
  Fly   201 NTFP------NDFYSKAPAMLIYTPNAVNSPKPVLLTH-RNIEAQMRCLIGTWHLGPTDCMLPIL 258

  Fly   229 SHNTLDWITGLLTTITSGVFSTTRIIADNAFDPAFALRIIEEYKVTWTIQPPSSMALMINCPDFE 293
            |.|.:......:.::...|....:....||:.....:....:.:||..:..|.....:|  .::|
  Fly   259 SMNRMHAALAAVLSVGGNVVLQQKFDGHNAWSALLGINSPSKQRVTLFLAMPIVYKRLI--VEYE 321

  Fly   294 TCDMSSLRCYMFG-GSRAALEVQKGIRSRLSHDCLQFV---------------------YGFTEL 336
            .         ||. .||....:....|.::......|.                     ||..|.
  Fly   322 K---------MFAKDSRMVEYIVNHCRQKIRLMATAFALLPDSVFYRWREITGQNIYEYYGMMET 377

  Fly   337 G----------------------AMATINCHFDEKTGSVGQLVNGLKMKIINDDG---------- 369
            |                      |||......|.:.|::|..:.|:..::|::.|          
  Fly   378 GLVLGHPLNKRQRDSPHNGPTAVAMANNTAPNDYRPGTLGSPLKGVTARLISNKGDELITCKNEL 442

  Fly   370 -----------ESLGPDE------IGEVCIM-----------NNQHW--SGYYGNEVETRNMRDS 404
                       |.:|.|.      |||:.|.           |||..  .|...|| |..|.:| 
  Fly   443 GGSVDSGLIPVEDIGGDASLAGTIIGELQIAGSNLVSNTLANNNQEMEHKGTTNNE-EQENNQD- 505

  Fly   405 LGWYHSGDL-GYMDRDGFLYIMDRKKEMLKYQNIMYYPNDIESVISEMPQVAEVCVFGIWSNIFG 468
             |::.:||: .|  |:|..|.:.:..::........|.::|:.|:...|.:.:|.|.||.:.::|
  Fly   506 -GFFKTGDICAY--RNGNFYFLSKSSDIFTVGGYKVYGSEIKKVLISHPNINDVAVLGIPNKMWG 567

  Fly   469 DEAAAAVVKKLGSELEAQDVVDY 491
            .......:....::::...:..|
  Fly   568 HRLGVICIVSPDADIDLDAIKTY 590

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6300NP_650828.1 CaiC 26..523 CDD:223395 110/578 (19%)
AFD_class_I 47..522 CDD:302604 106/556 (19%)
CG18155NP_996360.2 CaiC 53..604 CDD:223395 113/591 (19%)
AFD_class_I 58..607 CDD:302604 113/586 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24096
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.