DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6300 and Slc27a6

Sequence 1:NP_650828.1 Gene:CG6300 FlyBaseID:FBgn0038730 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001099615.1 Gene:Slc27a6 RGDID:1311977 Length:619 Species:Rattus norvegicus

Alignment Length:515 Identity:103/516 (20%)
Similarity:200/516 (39%) Gaps:74/516 (14%)


  Fly    32 GEII------FHEMRRHPQLTAQISATEGTVLTRGELLANAMRLA-SYMRSLGLLQSDIVGIIGR 89
            ||::      ....||.|:....|  .||.|.|..::...:.|:| :.:....|.:.|:|.::..
  Rat    51 GELVTVLDKFLSHARRQPKKAFII--YEGDVYTYEDVDKRSNRVAHALLNHSDLKRGDVVALLMS 113

  Fly    90 NTTHMLAVAYACFFNG--IAFHSLNITYDRDTIEKIYKVTRPSIIFCDGDEFEKVRSATAEL--D 150
            |....:.|.:.....|  :||.:.|:.:  :::....:.:.|..:....|....:......|  .
  Rat   114 NEPDFVHVWFGLAKLGCVVAFLNSNLRF--ESLLHCIRTSEPKAMVVGEDLLGSLEEILPSLPKH 176

  Fly   151 VKIVTMRNH-PLDSIKIDEVVATPIEENFQPA-KLEKGNDQTLAILCSSGTTGTPKAVTITNSRH 213
            :::..|::. |...:.:.|.::...:|...|: .:......|...:.:|||||.|||..|:..: 
  Rat   177 IRVWGMKDSVPEGIVSLKEKLSLASDEPVPPSHHVTSSLKSTCLYIFTSGTTGLPKAAVISQFQ- 240

  Fly   214 ILAGNYHL-----TTADVQYSHNTLDWITGLLTTITSGVFSTTRIIADNAFDPAFALRIIEEYKV 273
            :|.|::.|     |..|:.|....|...:|.|..|...|......:....|..:.......:|.|
  Rat   241 VLKGSFGLWAFGCTADDIVYITLPLYHSSGALLGIGGCVELGATCVLKKKFSASQFWNDCRKYNV 305

  Fly   274 TWTIQPPSSMALMINCPDFETCDMSSLRCYMFGGSRAALEVQKGIRSRLSHDCLQFVYGFTELGA 338
            | ..|....:...: |...:.......|..:..|:..:.:|.:....|..:..:...||.|| |.
  Rat   306 T-VFQYIGELCRYL-CKQPQREGEKDHRVRLAVGNGMSSDVWRQFLDRFGNIKMCEFYGATE-GN 367

  Fly   339 MATINCHFDEKTGSVGQLVNG-----LKMKIINDDGESLGPDEIGEVCIMNNQHWS--------- 389
            :..:|  ...|.||||: ||.     ...::|..|.:...|       :.|.|.|.         
  Rat   368 ICFMN--HTGKIGSVGR-VNFFYNLLFSFELIKYDFQKDEP-------LRNEQGWCYCVRKGEPG 422

  Fly   390 -------------GYYGNEVETRN------MRDSLGWYHSGDLGYMDRDGFLYIMDRKKEMLKYQ 435
                         ||.|:..:|::      .:....::::|||.:.|.:.|||..||..:..:::
  Rat   423 LLVSRVNKKNPFFGYTGSYKQTKSKLLFDVFKKGDVYFNTGDLMFQDHENFLYFWDRIGDTFRWK 487

  Fly   436 NIMYYPNDIESVISEMPQVAEVCVFGIWSNIFGDEAAA---AVVKKLGSELEAQDVVDYV 492
            .......::.:|:..:..:.|..|:|:  .:.|.|..|   :::.|....|:.:.:.|.|
  Rat   488 GENVATTEVANVLGRLDFIQEANVYGV--PVPGYEGKAGMTSIILKPNKSLDLEKMYDQV 545

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6300NP_650828.1 CaiC 26..523 CDD:223395 103/516 (20%)
AFD_class_I 47..522 CDD:302604 98/495 (20%)
Slc27a6NP_001099615.1 PRK08279 58..612 CDD:236217 101/509 (20%)
AFD_class_I 77..609 CDD:302604 96/488 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92499093
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.