DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6300 and Acsf3

DIOPT Version :9

Sequence 1:NP_650828.1 Gene:CG6300 / 42351 FlyBaseID:FBgn0038730 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_659181.2 Gene:Acsf3 / 257633 MGIID:2182591 Length:583 Species:Mus musculus


Alignment Length:574 Identity:122/574 - (21%)
Similarity:218/574 - (37%) Gaps:104/574 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LSIGEIIFHEMRRHPQL-TAQISATEGTVLTRGELLANAMRLA------------SYMRSL---- 76
            |:..::|....|.|..| |...:.|:|:|......||...|:|            .|.|||    
Mouse    16 LASSQLIPRRHRGHSLLPTTPEAHTDGSVPVFIRALAFGDRIALIDKYGHHTYRELYDRSLCLAQ 80

  Fly    77 ----------GLLQSDIVGIIGRNTTHMLAVAYACFFNGIAFHSLNITYDRDTIEKIYKVTRPSI 131
                      |.||.:.|..:..|....:...:|.:.:|.....|...:....:|...:.:|.|:
Mouse    81 EICRLQGCKVGDLQEERVSFLCSNDVSYVVAQWASWMSGGVAVPLYWKHPEAQLEYFIQDSRSSL 145

  Fly   132 IFCDGDEFEKVRSATAELDVKIVTMRNHPLDSIKIDEVVATPIEENFQPAKLEKGNDQTLAILCS 196
            :....:..|::......|.|.::     ||...........|.|   ||.:.....|:...|..:
Mouse   146 VVVGQEYLERLSPLAQRLGVPLL-----PLTPAVYHGATEKPTE---QPVEESGWRDRGAMIFYT 202

  Fly   197 SGTTGTPKAVTIT--NSRHILAGNYH----------LTTADVQYSHNTLD------WITGLLTTI 243
            |||||.||....|  |...::.|..|          |....:.:.|..::      |:..  |.:
Mouse   203 SGTTGRPKGALSTHRNLAAVVTGLVHSWAWTKNDVILHVLPLHHVHGVVNKLLCPLWVGA--TCV 265

  Fly   244 TSGVFSTTRI----IADNAFD-------PAFALRIIEEYKVTWTIQPPSSMALMINCPDF--ETC 295
            ....||..::    ::..|..       |....::::.|...:| ||        :..||  ..|
Mouse   266 MLPEFSAQQVWEKFLSSEAPQITVFMAVPTVYSKLLDYYDKHFT-QP--------HVQDFVRAVC 321

  Fly   296 DMSSLRCYMFGGSRAALEVQKGIRSRLSHDCLQFVYGFTELGAMATINCHFDEKT-GSVGQLVNG 359
             ...:|..:.|.:...:.:.:..||...|..|: .||.||:| ||..|...:.:. ||||..:.|
Mouse   322 -KERIRLMVSGSAALPVPLLEKWRSATGHTLLE-RYGMTEIG-MALSNPLTEARVPGSVGTPLPG 383

  Fly   360 LKMKII----------------NDDGESLGP---DEIGEVCIMNNQHWSGYYGNEVETRNMRDSL 405
            ::::||                |:.|..:.|   ::.||:.:.....:..|:....||::...|.
Mouse   384 VEVRIISENPQKGSPYIIHAEGNERGTKVTPGFEEKEGELLVRGPSVFREYWDKPEETKSAFTSD 448

  Fly   406 GWYHSGDLGYMDRDGFLYIMDRKK-EMLKYQNIMYYPNDIESVISEMPQVAEVCVFGIWSNIFGD 469
            ||:.:||.... :|...:|..|.. :::|.........:||..:...|.:.:|.|.|:....:|.
Mouse   449 GWFRTGDTAVF-KDARYWIRGRTSVDIIKTGGYKVSALEIERHLLAHPSITDVAVIGVPDMTWGQ 512

  Fly   470 EAAAAVVKKLGSELEAQDVVDYVRSRTDSKYKQLNGGAVIVDDLQRSANGKTNR 523
            ...|.|..:.|..|...|:.::.|. ..:.| .:....::|:::.|:..||.|:
Mouse   513 RVTAVVALQEGHSLSHGDLKEWARG-VLAPY-AVPSELLLVEEIPRNQMGKVNK 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6300NP_650828.1 CaiC 26..523 CDD:223395 121/572 (21%)
AFD_class_I 47..522 CDD:302604 115/552 (21%)
Acsf3NP_659181.2 MCS 55..569 CDD:341264 111/535 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.