DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6300 and Acsl1

Sequence 1:NP_650828.1 Gene:CG6300 FlyBaseID:FBgn0038730 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_036952.1 Gene:Acsl1 RGDID:2015 Length:699 Species:Rattus norvegicus

Alignment Length:459 Identity:111/460 (24%)
Similarity:170/460 (37%) Gaps:99/460 (22%)


  Fly    84 VGIIGRNTTHMLAVAYACFFNGIAFHSLNITYDRDTIEKIYKVTRPSIIFCDGDEFEKV------ 142
            :||..:|....:.:...||...:....|..|...|.|..|......|:||.|..|..|:      
  Rat   151 IGIFSQNRPEWVTIEQGCFTYSMVVVPLYDTLGTDAITYIVNKAELSVIFADKPEKAKLLLEGVE 215

  Fly   143 RSATAELDVKIVTMRNHPLDSIK------IDEVVATPIEE--NFQPAKLEKGNDQTLAILC-SSG 198
            ...|..|.: ||.|.::..|.::      ::.:....:|:  .....|.:....:.|||:| :||
  Rat   216 NKLTPCLKI-IVIMDSYDNDLVERGQKCGVEIIGLKALEDLGRVNRTKPKPPEPEDLAIICFTSG 279

  Fly   199 TTGTPKAVTIT--NSRHILAGNYHLTTA-------DVQYSHNTLDWITGLLTTITS--------- 245
            |||.||...:|  |..:..:|....|.:       ||..|...|   ..:..|:..         
  Rat   280 TTGNPKGAMVTHQNIMNDCSGFIKATESAFIASPEDVLISFLPL---AHMFETVVECVMLCHGAK 341

  Fly   246 -GVF-STTRIIADNAFDPAFALRIIEEYKVTWTIQP--PSSMALMINCPDFETCDMSSLRCYM-F 305
             |.| ...|::.|:       |::::.     ||.|  |..:..|.: ..|...:.|..|..: |
  Rat   342 IGFFQGDIRLLMDD-------LKVLQP-----TIFPVVPRLLNRMFD-RIFGQANTSVKRWLLDF 393

  Fly   306 GGSRAALEVQKGI---------------------RSRL--------SHDCLQFV----------- 330
            ...|...|::.||                     :.||        |...|.|:           
  Rat   394 ASKRKEAELRSGIVRNNSLWDKLIFHKIQSSLGGKVRLMITGAAPVSATVLTFLRAALGCQFYEG 458

  Fly   331 YGFTELGAMATINCHFDEKTGSVGQLV--NGLKMKIINDDGESLGPDEIGEVCIMNNQHWSGYYG 393
            ||.||..|...::...|...|.||..:  |.:|:..:.|........| ||||:.....:.||..
  Rat   459 YGQTECTAGCCLSLPGDWTAGHVGAPMPCNYIKLVDVEDMNYQAAKGE-GEVCVKGANVFKGYLK 522

  Fly   394 NEVETRNMRDSLGWYHSGDLGYMDRDGFLYIMDRKKEMLKYQNIMYY-PNDIESVISEMPQVAEV 457
            :...|....|..||.|:||:|....:|.|.|:||||.:.|.....|. |..||::......||:|
  Rat   523 DPARTAEALDKDGWLHTGDIGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENIYLRSEAVAQV 587

  Fly   458 CVFG 461
            .|.|
  Rat   588 FVHG 591

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6300NP_650828.1 CaiC 26..523 CDD:223395 111/460 (24%)
AFD_class_I 47..522 CDD:302604 111/460 (24%)
Acsl1NP_036952.1 PLN02736 87..697 CDD:178337 111/460 (24%)
LC-FACS_euk 117..694 CDD:213293 111/460 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C91720334
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.