DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6300 and Acsm3

Sequence 1:NP_650828.1 Gene:CG6300 FlyBaseID:FBgn0038730 Length:537 Species:Drosophila melanogaster
Sequence 2:XP_006230167.1 Gene:Acsm3 RGDID:62086 Length:581 Species:Rattus norvegicus

Alignment Length:364 Identity:89/365 (24%)
Similarity:166/365 (45%) Gaps:40/365 (11%)


  Fly   187 NDQTLAILCSSGTTGTPKAVTITNSRHILA----GNY--HLTTADVQYSHNTLDWITGLLTTITS 245
            :::.:||..:|||||.||.:..|:|...|.    |.:  .|..:||.:  ||.|  ||...:..|
  Rat   220 HNELMAIYFTSGTTGPPKMIGHTHSSFGLGLSVNGRFWLDLIASDVMW--NTSD--TGWAKSAWS 280

  Fly   246 GVFST----TRIIAD--NAFDPAFALRIIEEYKVTWTIQPPSSMALMINCPDFETCDMSSLRCYM 304
            .|||.    ..:.|.  ..||....|:.:.::.:|.....|::..::|......:...:||:..:
  Rat   281 SVFSPWTQGACVFAHYLPRFDSTSILQTLSKFPITVFCSAPTAYRMLIQNDITRSYKFNSLKHCV 345

  Fly   305 FGGSRAALEVQKGIRSRLSHDCLQFVYGFTELGAMATINC-HFDE---KTGSVGQLVNGLKMKII 365
            ..|.....||.:..:.:...|..: .||.||    ..:.| :|..   |.||:|:......::|:
  Rat   346 SAGEPINPEVMEQWKKKTGLDIYE-GYGQTE----TVLICGNFKGMKIKPGSMGKPSPAFNVEIL 405

  Fly   366 NDDGESLGPDEIGEVCIMNNQH-----WSGYYGNEVETRN-MRDSLGWYHSGDLGYMDRDGFLYI 424
            :::|..|.|.:.|::.:.....     ::.|..|..:|.: :|.:  :|.:||.||||.||:.:.
  Rat   406 DENGTILPPGQEGDIAVQVLPDRPFGLFTHYVDNPSKTASTLRGN--FYITGDRGYMDEDGYFWF 468

  Fly   425 MDRKKEMLKYQNIMYYPNDIESVISEMPQVAEVCVFGIWSNIFGDEAAAAVVKKLGSELEAQ--- 486
            :.|..:::........|.::||.:.|.|.:||..|......|.|:...|.:|.....:|..|   
  Rat   469 VARSDDVILSSGYRIGPFEVESALIEHPSIAESAVVSSPDPIRGEVVKAFIVLNPDYKLHDQEQL 533

  Fly   487 --DVVDYVRSRTDSKYKQLNGGAVIVDDLQRSANGKTNR 523
              ::.::|: :|.:.||... ....:::|.::.:||..|
  Rat   534 KKEIQEHVK-KTTAPYKYPR-KIEFIEELPKTVSGKVKR 570

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6300NP_650828.1 CaiC 26..523 CDD:223395 88/363 (24%)
AFD_class_I 47..522 CDD:302604 88/362 (24%)
Acsm3XP_006230167.1 Acs 45..575 CDD:223442 89/365 (24%)
AFD_class_I 48..578 CDD:302604 89/365 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.