DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6300 and Acsm2

Sequence 1:NP_650828.1 Gene:CG6300 FlyBaseID:FBgn0038730 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001171448.1 Gene:Acsm2 MGIID:2385289 Length:600 Species:Mus musculus

Alignment Length:495 Identity:103/496 (21%)
Similarity:196/496 (40%) Gaps:73/496 (15%)


  Fly    77 GLLQSDIVGIIGRNTTHMLAVAYACFFNGIAFHSLNITY-DRDTIEKIYKVTRPSIIFCDGDEFE 140
            ||.:.|.|.::.........:...|...|:.|....|.. ..|.:.::......:|:  .|||..
Mouse   127 GLHRGDRVAVVLPRIPEWWLMILGCMRTGLVFMPGTIQMRSSDILYRLQASKARAIV--AGDEVA 189

  Fly   141 KVRSATAE----LDVKIVTMRNHPLDSIKIDEVV--ATPIEENFQPAKLEKGNDQTLAILCSSGT 199
            :...|.|.    |.:|::...|.....:....::  |:.|.:     .:|..:.::.||..:|||
Mouse   190 QEVDAVAPDCSFLKIKLLVSENSREGWLNFKALLKEASTIHQ-----CVETESRESAAIYFTSGT 249

  Fly   200 TGTPKAVTITNSRHILAGNYH----------------LTTADVQYSHNTLDWITGLLTTITSGVF 248
            :|.||          :|.:.|                |:|:|:.::.:...||..:|     |.|
Mouse   250 SGPPK----------MAEHSHCSLGIKAKMDAASWTGLSTSDIIWTISDTAWIMNIL-----GAF 299

  Fly   249 STTRIIAD-------NAFDPAFALRIIEEYKVTWTIQPPSSMALMINCPDFETCDMSSLRCYMFG 306
            ....::..       ..||....|:::..|.:...:..|....:::. .|..:.....|.....|
Mouse   300 LEPWVLGACIFVHLLPKFDSQTVLKVLSSYPINTLVGAPIIYRMLLQ-QDLSSYKFPHLHSCFSG 363

  Fly   307 GSRAALEVQKGIRSRLSHDCLQFVYGFTELGAMATINCHFDEKTGSVGQLVNGLKMKIINDDGES 371
            |.....|..:..:::...: ::.:||.||.|.:..::.....|.|.:|.......:::|::.|..
Mouse   364 GETLLPETLENWKAKTGLE-IREIYGQTETGLICRVSRTMKVKPGYLGTAFAHYDVQVIDEQGNV 427

  Fly   372 LGPDEIGEVCIMNNQHW-----SGYYGNEVETR-NMRDSLGWYHSGDLGYMDRDGFLYIMDRKKE 430
            |.|.:.|::.|.....|     |||..|..:|: |:|... |. .||.|..|.:|:.:.:.|..:
Mouse   428 LPPGKEGDIAIRVKPIWPIGMFSGYVDNPKKTQDNIRGDF-WL-MGDRGIKDPEGYFHFIGRSDD 490

  Fly   431 MLKYQNIMYYPNDIESVISEMPQVAEVCVFGIWSNIFGDEAAAAVVKKLGSELEAQD-------V 488
            ::........|:::|:.:.|.|.|:|..|........|:...|.||  |..|..:.|       :
Mouse   491 IINSSGYRIGPSEVENALMEHPAVSETAVISSPDPSRGEVVKAFVV--LAPEFLSHDRDQLTKVL 553

  Fly   489 VDYVRSRTDSKYKQLNGGAVIVDDLQRSANGKTNRMANKA 528
            .::|:|.| :.||.......:: ||.::..||..|...:|
Mouse   554 QEHVKSVT-APYKYPRKVEFVL-DLPKTVTGKIERAKLRA 591

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6300NP_650828.1 CaiC 26..523 CDD:223395 101/489 (21%)
AFD_class_I 47..522 CDD:302604 101/488 (21%)
Acsm2NP_001171448.1 Acs 65..591 CDD:223442 102/494 (21%)
AFD_class_I 66..594 CDD:302604 103/496 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.