DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6300 and Slc27a6

Sequence 1:NP_650828.1 Gene:CG6300 FlyBaseID:FBgn0038730 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001074541.1 Gene:Slc27a6 MGIID:3036230 Length:619 Species:Mus musculus

Alignment Length:521 Identity:104/522 (20%)
Similarity:207/522 (40%) Gaps:86/522 (16%)


  Fly    32 GEII------FHEMRRHPQLTAQISATEGTVLTRGELLANAMRLA-SYMRSLGLLQSDIVGIIGR 89
            ||::      ....|:.|:....|  .||.|.|..::...:.|:| :.:....|.:.|:|.::..
Mouse    51 GELVTVLDKFLSHTRKQPRKAFII--YEGDVYTYEDVDKRSNRIAHALLNHSSLKRGDVVALLMS 113

  Fly    90 NTTHMLAVAYACFFNG--IAFHSLNITYDRDTIEKIYKVTRPSIIFCDGDEFEKVRSATAEL--D 150
            |....:.|.:.....|  :||.:.|:.:  |::........|:.:...||....:......|  .
Mouse   114 NEPDFVHVWFGLAKLGCVVAFLNSNLRF--DSLLHCINTCEPTAVVVGGDLLGSIEEILPSLPKH 176

  Fly   151 VKIVTMRNHPLDSI-KIDEVVATPIEENFQPA-KLEKGNDQTLAILCSSGTTGTPKAVTITNSRH 213
            |::..|::...:.| .:.|.::...:|...|: .:......|...:.:|||||.|||..|:..: 
Mouse   177 VRVWGMKDSVPEGIDSLQEKLSLASDEPVPPSHHVTSSLKSTCLYIFTSGTTGLPKAAVISQLQ- 240

  Fly   214 ILAGNYHL----TTAD--------VQYSHNTLDWITGLL----TTITSGVFSTTRIIADNAFDPA 262
            :|.|:..|    .|||        :.:|..:|..|.|.:    |.:....||.::...|      
Mouse   241 VLKGSVGLWAFGCTADDIIYITLPLYHSSGSLLGIGGCVELGATCVLKKKFSASQFWND------ 299

  Fly   263 FALRIIEEYKVTWTIQPPSSMALMINCPDFETCDMSSLRCYMFGGSRAALEVQKGIRSRLSHDCL 327
                 .::|.|| ..|....:...: |...:.......|..:..|:..:.:|.:....|..:..:
Mouse   300 -----CKKYNVT-VFQYIGELCRYL-CKQPQREGEKDHRVRLAVGNGLSSDVWRQFLDRFGNIKM 357

  Fly   328 QFVYGFTELGAMATINCHFDEKTGSVGQLVNG-------LKMKIINDDGESLGPDEIGE---VCI 382
            ..:||.|| |     |..|...||.:|.:...       ...::|..|.:...|...|:   .|:
Mouse   358 CELYGATE-G-----NIVFMNHTGKIGSVGRANFFYSLFFSFELIKYDFQKDEPWRNGQGWCSCV 416

  Fly   383 -----------MNNQH-WSGYYGNEVETRN------MRDSLGWYHSGDLGYMDRDGFLYIMDRKK 429
                       :|.:: :.||.|::..|::      .|....::::|||.:.|::.|:|..||..
Mouse   417 RKGEPGLLISRVNKKNPFFGYAGSDTHTKSKLLFDVFRKGDVYFNTGDLMFQDQENFVYFWDRLG 481

  Fly   430 EMLKYQNIMYYPNDIESVISEMPQVAEVCVFGIWSNIFGDEAAA---AVVKKLGSELEAQDVVDY 491
            :..:::.......::..|:..:..:.|..|:|:  .:.|.|..|   :|:.|....|:.:.:.:.
Mouse   482 DTFRWKGENVATTEVADVLGRLDFIQEANVYGV--RVPGYEGKAGMTSVILKPNKSLDLEKMYNQ 544

  Fly   492 V 492
            |
Mouse   545 V 545

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6300NP_650828.1 CaiC 26..523 CDD:223395 104/522 (20%)
AFD_class_I 47..522 CDD:302604 100/501 (20%)
Slc27a6NP_001074541.1 PRK08279 58..619 CDD:236217 102/515 (20%)
AFD_class_I 77..609 CDD:302604 98/494 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92497309
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.