DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6300 and acs-1

Sequence 1:NP_650828.1 Gene:CG6300 FlyBaseID:FBgn0038730 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001023937.1 Gene:acs-1 WormBaseID:WBGene00018488 Length:623 Species:Caenorhabditis elegans

Alignment Length:555 Identity:130/556 (23%)
Similarity:224/556 (40%) Gaps:94/556 (17%)


  Fly    30 SIGEIIFHEMRRHPQLTAQISATEGTVLTRGELLANAMRLASYMRSLGLLQSDIVGIIGRNTTHM 94
            ::|:.:...:.:.|.....|...||...|..::..:|..||..:..|||.:.|.:||.|.||...
 Worm    67 TVGDRLRSAVDQVPDKEFLIFKREGIRKTYSQVATDAENLACGLLHLGLKKGDRIGIWGPNTYEW 131

  Fly    95 LAVAYACFFNGIAFHSLNITYD----RDTIEKI---YKVTRPSIIFCDGDEFEKVRSATAELDVK 152
            ....:|....|:...::|.:|.    |..|||:   ..:|.|.  |...:.::.::....|:.:|
 Worm   132 TTTQFASALAGMVLVNINPSYQSEELRYAIEKVGIRALITPPG--FKKSNYYQSIKDILPEVTLK 194

  Fly   153 I-----VTMRN-----HPL-----DSI-----KIDEVVATPIEEN-FQPAKLEKGN--DQTLAIL 194
            .     :|.||     |.:     |.|     |..:|:....||: ...:|:|:..  |.:|.|.
 Worm   195 EPGKSGITSRNFTCFQHLIMFDEEDKIYPGAWKYTDVMKMGTEEDRHHLSKIERETQPDDSLNIQ 259

  Fly   195 CSSGTTGTPKAVTITNSRHILAGNYHLTTADVQYS------------HNTLDWITGLLTTITSGV 247
            .:|||||.||..|:|:  |.:..|.........||            ::....:.|:|..:|   
 Worm   260 YTSGTTGQPKGATLTH--HNVLNNAFFVGLRAGYSEKKTIICIPNPLYHCFGCVMGVLAALT--- 319

  Fly   248 FSTTRIIADNAFDPAFALRIIEEYKVTWTIQPPSSMALMINCPDFETCDMSSLRCYMFGGSRAAL 312
            ...|.:....:||...||:.|.|.|.|.....|:....|||.|::...:..|:|.....|:...:
 Worm   320 HLQTCVFPAPSFDALAALQAIHEEKCTALYGTPTMFIDMINHPEYANYNYDSIRSGFIAGAPCPI 384

  Fly   313 EVQKGIRSRLSHDCLQFVYGFTELGAMATINCHFD---EKTGSVGQLVNGLKMKIINDDGESLGP 374
            .:.:.:...:....:|..||.||...::.::...|   ::..|||.:::.|:..|: |....:.|
 Worm   385 TLCRRLVQDMHMTDMQVCYGTTETSPVSFMSTRDDPPEQRIKSVGHIMDHLEAAIV-DKRNCIVP 448

  Fly   375 DEI-GEVCIMNNQHWSGYYGNEVETRNMRDSLGWYHSGDLGYMDRDGFLYIMDRKKEMLKYQNIM 438
            ..: |||.:........|:.:|.:|:.......|||:||:..|..:|.:.|:.|.|:|:......
 Worm   449 RGVKGEVIVRGYSVMRCYWNSEEQTKKEITQDRWYHTGDIAVMHDNGTISIVGRSKDMIVRGGEN 513

  Fly   439 YYPNDIESVISEMPQVAEVCVFGIWSNIFGDEAAAAVVKKLGSELEAQDVVDYVRSRTDSKYKQL 503
            .||.::|..:.:...|.:|.:.|:....||:...|                 :||          
 Worm   514 IYPTEVEQFLFKHQSVEDVHIVGVPDERFGEVVCA-----------------WVR---------- 551

  Fly   504 NGGAVIVDDLQRSANGKTNRMANKAY----FLHLK 534
                     |..||.|||.....||:    ..|.|
 Worm   552 ---------LHESAEGKTTEEDIKAWCKGKIAHFK 577

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6300NP_650828.1 CaiC 26..523 CDD:223395 126/539 (23%)
AFD_class_I 47..522 CDD:302604 124/521 (24%)
acs-1NP_001023937.1 PRK08315 53..615 CDD:236236 130/556 (23%)
FACL_like_2 252..604 CDD:213284 87/369 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.