DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6300 and C32E8.6

Sequence 1:NP_650828.1 Gene:CG6300 FlyBaseID:FBgn0038730 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_740831.1 Gene:C32E8.6 WormBaseID:WBGene00016324 Length:461 Species:Caenorhabditis elegans

Alignment Length:548 Identity:123/549 (22%)
Similarity:208/549 (38%) Gaps:125/549 (23%)


  Fly    12 DQKIWSGEPVVKYFDPDLSIGEIIFHEMRRHPQLTAQISATEGTVLTRGELLANAMRLASYMRSL 76
            :..|:..:..:.:.|.::|..|  |||         .|...:..:..:.....|.:|:|.:.   
 Worm    12 ETSIFENKTCLIWRDREISFKE--FHE---------YIGKWKNVLDEQKTKTTNPLRIALFC--- 62

  Fly    77 GLLQSDIVGIIGRNTTHMLAVAYACFFNGIAFHSLNITYDRDTI-EKIYKVTRPSIIFCDGDEFE 140
                        .|:..:||:..|...:|:....||.:|.:..| |.|.|.....||..|..:.:
 Worm    63 ------------TNSPDILAIIVAGQLSGVTVIPLNPSYKKYEIDEYISKSIANFIIVSDDVDLD 115

  Fly   141 KVRSATAELDVKIVTMRNHPLDSIKIDEVVATPIEENFQPAKLEKGNDQTLAILCSSGTTGTPKA 205
            |.......|..::.|....|      ....:||  ||           |.:.:..||||||.||.
 Worm   116 KFEEREVNLISELFTSNVTP------SSTASTP--EN-----------QGVIVFFSSGTTGPPKQ 161

  Fly   206 VTITNSRHILAGN-------------YHLTTADVQYSHNTLDWI-TGLLTTITSGVFSTTRIIAD 256
            ...|  :.||...             :..:|.|:.|  ..|.:. .|.|.||.|.:||...::.:
 Worm   162 FEYT--QRILCSQIDQIKAIRSDPRFFSPSTDDICY--GVLPFFHAGGLITILSMIFSGCTVLIN 222

  Fly   257 NAFDPAFALRIIEEYKVTWTIQPPSSMALMINCPDFETCDMSSLRCYMFGGSRAALEVQKGIRSR 321
            ..::....|...:.|||:.....|..:....|.|...:.|:|:|:....|.:.:..|....:..|
 Worm   223 ERWNEHEFLANCQNYKVSVLFLVPPVLNFFANHPLVSSYDLSALKTIYVGAAASPPENFAKVAER 287

  Fly   322 LSH-DCLQFVYGFTELGAMATINCHFDEKTG-------SVGQLVNGLKMKIINDDGESLGPDEIG 378
            |.. :.|..:||.:|.|.:.   |    .||       :||.....:::||        .|:   
 Worm   288 LPELENLIQLYGTSECGVLL---C----STGKGKASGKTVGWPFPFVELKI--------NPE--- 334

  Fly   379 EVCIMNNQHWSGYYGNEVETRN---MRDSLGWYHSGDLGYMD-RDGFLYIMDRKKEMLKYQNIMY 439
                          .||:..::   |.:  |:..:||||.:. :...|.|:.|.|||:|.:....
 Worm   335 --------------NNEIFVKSATAMEE--GFMETGDLGCLSFKTIELMIVGRSKEMMKIRGWQV 383

  Fly   440 YPNDIESVISEMPQVAEVCVFGIWSNIFGDEAAAAVVKKLGSELEAQDVVDYVRSRTDSKYKQLN 504
            .||::|.||.::..|.:..|:        ........|.:|:.....|:...|:....| ||||:
 Worm   384 NPNEVEDVIRKVEGVLDCAVY--------QNQEKLTAKIIGNPDSKADIFKIVKDNLAS-YKQLD 439

  Fly   505 GGAVIVDDLQRSANGKTNRMANKAYFLH 532
             ..:.|::|.|:.:||..|     :.||
 Worm   440 -DVIFVEELPRNPSGKLVR-----HMLH 461

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6300NP_650828.1 CaiC 26..523 CDD:223395 119/524 (23%)
AFD_class_I 47..522 CDD:302604 113/502 (23%)
C32E8.6NP_740831.1 CaiC 8..457 CDD:223395 120/538 (22%)
AFD_class_I 57..455 CDD:302604 111/480 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24096
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.960

Return to query results.
Submit another query.