DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6300 and acsl4

Sequence 1:NP_650828.1 Gene:CG6300 FlyBaseID:FBgn0038730 Length:537 Species:Drosophila melanogaster
Sequence 2:XP_017952080.1 Gene:acsl4 XenbaseID:XB-GENE-5966957 Length:506 Species:Xenopus tropicalis

Alignment Length:420 Identity:84/421 (20%)
Similarity:150/421 (36%) Gaps:100/421 (24%)


  Fly    29 LSIGEIIFHEMRRHP--QLTAQISATEGTVLTRGELLANAMRLASYMRSLGLLQSDIVGIIGRNT 91
            |...||:..|..:.|  ::..::...|...|:..|:......|.|.:.:|||.....:.|.....
 Frog    96 LGTREILSEENEKQPNGKVFKKLILGEYKWLSYEEVSLRVHHLGSGLSALGLKPKSTIAIFCETR 160

  Fly    92 THMLAVAYACFFNGIAFHSLNITYDRDTIEKIYKVTRPSIIFCDGDEFE-KVRSATAE------- 148
            ...:..|.|||.......:|..|...:.:......:..|.:|...:..| |::|..::       
 Frog   161 AEWMITAQACFKYNFPLVTLYATLGEEAVAYGLNESGASYLFTSAELLETKLKSVLSQVTGLKHI 225

  Fly   149 --LDVKIVTMRNHPLDSIKIDEVVATPIEE-NFQPAKLEKGNDQTL-----AILCSSGTTGTPKA 205
              :..|.::...:|. |::|..:.|  :|| ..:...|.|...:.|     .::.:||:||.||.
 Frog   226 IYVGKKNISKAEYPA-SLEIHNIEA--VEELGAKQENLSKPTSRPLPSDLAVVMYTSGSTGRPKG 287

  Fly   206 VTITNSRHI--LAGNYH----LTTADVQYSHNTLDWI---TGLLTTITSGV---FSTTRIIADNA 258
            |.:.:|..|  :||...    |...|....:..|..:   |..::.:|.|.   :|:...::|. 
 Frog   288 VMMIHSNLIAGMAGQCERIPGLGPKDTYIGYLPLAHVLEMTAEISCVTYGCRIGYSSPLTLSDQ- 351

  Fly   259 FDPAFALRIIEEYKVTWTIQPPSSMALMINCPD---------------FE--------------- 293
                 :.:|.:..|...|:..|:.||.:....|               |:               
 Frog   352 -----SSKIKKGSKGDCTVLRPTLMAAVPEIMDRIYKNVMSKVQEMNVFQRTLFKLGYDYKLEQI 411

  Fly   294 -------TCDM-----------SSLRCYMFGGSRAALEVQKGIRSRLSHDCLQFV------YGFT 334
                   .|:|           .::|..:.||:..:.:.|     |..:.|  |.      ||.|
 Frog   412 KKGYDAPLCNMLLFKKVKALLGGNVRMMLCGGAPLSPQTQ-----RFMNIC--FCCPVGQGYGLT 469

  Fly   335 ELGAMATINCHFDEKTGSVGQLVNGLKMKI 364
            |.....||....|..||.||..:...:||:
 Frog   470 ETCGAGTITEVCDYSTGRVGAPLTCCEMKL 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6300NP_650828.1 CaiC 26..523 CDD:223395 84/421 (20%)
AFD_class_I 47..522 CDD:302604 79/401 (20%)
acsl4XP_017952080.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C91873208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.