DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6300 and dip2a

Sequence 1:NP_650828.1 Gene:CG6300 FlyBaseID:FBgn0038730 Length:537 Species:Drosophila melanogaster
Sequence 2:XP_009302675.1 Gene:dip2a ZFINID:ZDB-GENE-091204-2 Length:1589 Species:Danio rerio

Alignment Length:596 Identity:138/597 (23%)
Similarity:229/597 (38%) Gaps:161/597 (27%)


  Fly    52 TEGTVLTRG---ELLANAMRLASYMRSLGLLQS-DIVGIIGRNTTHMLAVAYACFFNGIA----- 107
            ::|||:...   :|...|.|:|..:...|.|.: |.|.::......::|..|.|.:.|..     
Zfish  1027 SKGTVVNTASCVQLHKRAERVALALMERGRLNAGDHVALLYPPGIDLIATFYGCLYAGCVPVTVR 1091

  Fly   108 -FHSLNITYDRDTIEKIYKVTRPSIIFCDGD--EFEKVRSATAELDVKIVTMRNHPLDSIKIDEV 169
             .|..|:|....|::.|.:|::...|.....  :..|.:.|.|.:|:|.     .|| .:..|::
Zfish  1092 PPHPQNLTTTLPTVKMIVEVSKSVCILTTQAIMKLLKSKEAAAAVDIKA-----WPL-ILDTDDL 1150

  Fly   170 VATPIEENFQPAKLEKGNDQTLAIL-CSSGTTGTPKAVTITNSRHILAGNYHLTTADVQYSHNT- 232
            ....:.:.::|.     :.:.||.| .|..|||            ||||        |:.||.. 
Zfish  1151 PRKRLPQIYKPP-----SPEMLAYLDFSVSTTG------------ILAG--------VKMSHAAT 1190

  Fly   233 ----------------------LDWITGL------LTTITSGVFSTTRIIADNAFDPAFALRIIE 269
                                  ||...||      |.::.||..|......:...:.:..|..:.
Zfish  1191 SALCRSIKLQCELYPSRQIAICLDPYCGLGFALWCLCSVYSGHQSILVPPLELETNASLWLSAVS 1255

  Fly   270 EYKVTWTIQPPSSMALMINCPD----------FETCDMSSLRCYM-------------------- 304
            :|||..|.   .|.::|..|..          ....::|.:|..|                    
Zfish  1256 QYKVRVTF---CSYSVMEMCTKGLGSQTEALRLRNVNLSCVRTCMVVAEERPRITLTQSFSKIFK 1317

  Fly   305 -FGGSRAALEVQKGIRSRLSHDCLQFVYG------FTELGAMATINCHFDEKTGS--------VG 354
             .|.|..|:....|.|..:: .|||...|      :.::.|:........|: ||        .|
Zfish  1318 DLGLSTRAVSTTFGCRVNVA-VCLQGTAGPDPTTVYLDMRALRHDRVRLVER-GSPHSLPLMESG 1380

  Fly   355 QLVNGLKMKIINDDGES-LGPDEIGEVCIMNNQHWSGY---YGNE---VETRNMRDSLG-----W 407
            :::.|:|:.|.|.:.:. ||...:|||.:.:..:.:||   ||.|   .:..|.|.|.|     |
Zfish  1381 KILPGVKVIIANTETKGPLGDSHLGEVWVSSPHNATGYYTVYGEEALHADHFNTRLSFGDTQTVW 1445

  Fly   408 YHSGDLGYM----------DRDGFLYIMDRKKEMLKYQNIMYYPNDIE-SVISEMPQVAEVCVFG 461
            ..:|.||::          :|...||::....|.|:.:.:.|:|.||| |||.....:||..|| 
Zfish  1446 ARTGYLGFLRRTELTDASGERHDALYVVGALDETLELRGMRYHPIDIETSVIRSHKSIAECAVF- 1509

  Fly   462 IWSNIFGDEAAAAVVKKLGSELEAQDVVDYVRSRTDSKYKQLNGGAVIVDD--LQRSANGKTNRM 524
            .|:|:.     ..||:..|||.||.|:|..|.:....::..:.|..|:||.  :..::.|:..||
Zfish  1510 TWTNLL-----VVVVELEGSEQEALDLVALVTNVVLEEHYLIVGVVVVVDPGVIPINSRGEKQRM 1569

  Fly   525 ANKAYFLHLKN 535
                   ||::
Zfish  1570 -------HLRD 1573

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6300NP_650828.1 CaiC 26..523 CDD:223395 134/583 (23%)
AFD_class_I 47..522 CDD:302604 134/582 (23%)
dip2aXP_009302675.1 DMAP_binding 19..132 CDD:283995
CaiC 349..927 CDD:223395
AFD_class_I 375..939 CDD:302604
AMP-binding 1009..1483 CDD:278902 105/492 (21%)
AFD_class_I 1026..1578 CDD:302604 138/597 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.