DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6300 and zgc:158482

Sequence 1:NP_650828.1 Gene:CG6300 FlyBaseID:FBgn0038730 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001076488.1 Gene:zgc:158482 ZFINID:ZDB-GENE-070209-32 Length:619 Species:Danio rerio

Alignment Length:528 Identity:119/529 (22%)
Similarity:204/529 (39%) Gaps:106/529 (20%)


  Fly    53 EGTVLTRGELLANAMRLA-SYMRSLGLLQSDIVGIIGRNTTHMLAVAYACFFNGIAFHSLNITYD 116
            ||..||..:....:.|:| :.:|..|:...|...:...|....:....|....|.|...||.:..
Zfish    75 EGQTLTYRDADRESNRIANALLRECGMRAGDTAALFITNQPAFILCWIALAKLGCACALLNTSIR 139

  Fly   117 RDTIEKIYKVTRPSIIFCDGDEFEKVRSATAELDVKI-------------VTMRNHPLDSIKIDE 168
            .|::.:.::..|.:          ||..|:|:|...:             |.|.......::...
Zfish   140 DDSLIRSFRCCRGA----------KVLIASADLQAAVQQVCVPLQQDGVCVLMMGMECSGMRSLS 194

  Fly   169 VVATPIEENFQPA--KLEKGNDQTLAILCSSGTTGTPKAVTITNSRHILAG-----NYHLTTADV 226
            ..|....:...||  :....|:.....:.:|||||.|||..||.:| :||.     :..:|..||
Zfish   195 RAAQESSDTAVPAAVRAHLTNNTPAVYIYTSGTTGLPKAAVITQTR-LLASLAVLPSIGVTHTDV 258

  Fly   227 QY----SHNTLDWITGLLTTITSG-------VFSTTRIIADNAFDPAFALRIIEEYKVTWTIQPP 280
            .|    .::|..::.|.:..:.:|       .||.:|.     :|...|      ::||......
Zfish   259 LYVTLPLYHTAGFLIGFMGCVETGSSMVLRRKFSASRF-----WDECRA------HEVTVVQYIG 312

  Fly   281 SSMALMINCPDFETCDMSSLRCYMFGGSRAALEVQKGIRSRLSHDCLQFVYGFTELGAMATINCH 345
            ..:..:.|.|........::|..:..|.||  :|.:....|.....::..|..|| |.:..:|  
Zfish   313 EILRYLCNTPQRAVDQHHAVRLAIGNGLRA--DVWREFLQRFGQMEVREFYASTE-GNIGFLN-- 372

  Fly   346 FDEKTGSVGQLVNGLKMKI----INDDGESLGP--DEIGE----------VCIMNNQHWSGYYG- 393
            :..:.|:||::....:|.:    |..|.|...|  |..|.          :.:....|.:.:.| 
Zfish   373 YTGRLGAVGRVSFLHRMAVHYALIQFDTEREEPVRDSSGRCVEVPKGQTGLLVSQITHMAPFVGY 437

  Fly   394 ----NEVETRNMRDSLG----WYHSGDLGYMDRDGFLYIMDRKKEMLKYQNIMYYPNDIESVISE 450
                .:.|.:.:||...    :::||||..||:|.|||.:||..:..:::.......::..|:|.
Zfish   438 AHDEQQTERKRLRDVFRRGDVYFNSGDLMRMDQDNFLYFIDRVGDTFRWKGENVATTEVSDVLSL 502

  Fly   451 MPQVAEVCVFGIWSNIFGDE---AAAAVVKKLGSELEAQDVVD--------YVRSR--------- 495
            :..|||..|:|:.  :.|.|   ..|||..|.|:|.|.:.|.:        |.|.|         
Zfish   503 LECVAEASVYGVC--VPGHEGRIGMAAVKLKDGAEFEQKQVFEHVSRLLPAYARPRFLRLQSSME 565

  Fly   496 TDSKYKQL 503
            ..|.:|||
Zfish   566 LTSTFKQL 573

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6300NP_650828.1 CaiC 26..523 CDD:223395 119/529 (22%)
AFD_class_I 47..522 CDD:302604 119/529 (22%)
zgc:158482NP_001076488.1 PRK08279 24..619 CDD:236217 119/529 (22%)
AFD_class_I 76..609 CDD:302604 118/528 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92446494
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.