DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Naam and PNC1

Sequence 1:NP_001262738.1 Gene:Naam FlyBaseID:FBgn0051216 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_011478.3 Gene:PNC1 SGDID:S000003005 Length:216 Species:Saccharomyces cerevisiae

Alignment Length:231 Identity:71/232 (31%)
Similarity:110/232 (47%) Gaps:45/232 (19%)


  Fly    96 VNAFLIVDVQNDFIS--GSLDISNCSAQQQGHEILEPINKLLDTVDFD--AVFYSLDWHPSDHVS 156
            :...::||:||||||  |||.:      .:|.|::.||:.|:...|.|  .:..:.|||||.|:|
Yeast     1 MKTLIVVDMQNDFISPLGSLTV------PKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHIS 59

  Fly   157 FIDNVKMRPMDESSALDSDSAKVFDTVIFAGPPP-----MKQRLWPRHCVQDSWGAEL------- 209
            |..|.|             ..:.:.|..:..|.|     .:..|||.|||:::||::|       
Yeast    60 FAKNHK-------------DKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQ 111

  Fly   210 --HKDLKVVDHGIKVYKGTNPEVDSYSVFWDNKKLSDTTLNAQLKMKGATDIYVCGLAYDVCVGA 272
              .|.:|:||      ||...:.:.||.|.|......|.:|..|:.....::|:.|:|.:.||.|
Yeast   112 VVTKHIKIVD------KGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKA 170

  Fly   273 TAVDALSAGYRTILIDDCCR--GTDVHDIEHTKEKV 306
            ||:.|...||:|.::.|..|  ..|...|...||::
Yeast   171 TAISAAELGYKTTVLLDYTRPISDDPEVINKVKEEL 206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NaamNP_001262738.1 EFh 20..81 CDD:238008
EF-hand_7 21..82 CDD:290234
nicotinamidase 97..315 CDD:238493 71/231 (31%)
PNC1NP_011478.3 nicotinamidase 1..214 CDD:238493 71/232 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1335
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H5938
Inparanoid 1 1.050 104 1.000 Inparanoid score I1411
Isobase 1 0.950 0 Normalized mean entropy S12195
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0010903
OrthoInspector 1 1.000 T1136292
orthoMCL 1 0.900 OOG5_127752
Panther 1 1.100 LDO PTHR11080
Phylome 1 0.910 0.881 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R16483
TreeFam 00.000 Not matched by this tool.
109.840

Return to query results.
Submit another query.