DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naam and PNC1

DIOPT Version :9

Sequence 1:NP_001262738.1 Gene:Naam / 42348 FlyBaseID:FBgn0051216 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_011478.3 Gene:PNC1 / 852846 SGDID:S000003005 Length:216 Species:Saccharomyces cerevisiae


Alignment Length:231 Identity:71/231 - (30%)
Similarity:110/231 - (47%) Gaps:45/231 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 VNAFLIVDVQNDFIS--GSLDISNCSAQQQGHEILEPINKLLDTVDFD--AVFYSLDWHPSDHVS 156
            :...::||:||||||  |||.:      .:|.|::.||:.|:...|.|  .:..:.|||||.|:|
Yeast     1 MKTLIVVDMQNDFISPLGSLTV------PKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHIS 59

  Fly   157 FIDNVKMRPMDESSALDSDSAKVFDTVIFAGPPP-----MKQRLWPRHCVQDSWGAEL------- 209
            |..|.|             ..:.:.|..:..|.|     .:..|||.|||:::||::|       
Yeast    60 FAKNHK-------------DKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQ 111

  Fly   210 --HKDLKVVDHGIKVYKGTNPEVDSYSVFWDNKKLSDTTLNAQLKMKGATDIYVCGLAYDVCVGA 272
              .|.:|:||      ||...:.:.||.|.|......|.:|..|:.....::|:.|:|.:.||.|
Yeast   112 VVTKHIKIVD------KGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKA 170

  Fly   273 TAVDALSAGYRTILIDDCCR--GTDVHDIEHTKEKV 306
            ||:.|...||:|.::.|..|  ..|...|...||::
Yeast   171 TAISAAELGYKTTVLLDYTRPISDDPEVINKVKEEL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NaamNP_001262738.1 EFh 20..81 CDD:238008
EF-hand_7 21..82 CDD:290234
nicotinamidase 97..315 CDD:238493 71/230 (31%)
PNC1NP_011478.3 nicotinamidase 1..214 CDD:238493 71/231 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I1500
eggNOG 1 0.900 - - E1_COG1335
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H5938
Inparanoid 1 1.050 104 1.000 Inparanoid score I1426
Isobase 1 0.950 - 0 Normalized mean entropy S12195
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007602
OrthoInspector 1 1.000 - - oto100159
orthoMCL 1 0.900 - - OOG6_100439
Panther 1 1.100 - - LDO PTHR11080
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16483
SonicParanoid 1 1.000 - - X6476
TreeFam 00.000 Not matched by this tool.
1211.840

Return to query results.
Submit another query.