DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Naam and AT3G16190

Sequence 1:NP_001262738.1 Gene:Naam FlyBaseID:FBgn0051216 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_566539.1 Gene:AT3G16190 AraportID:AT3G16190 Length:196 Species:Arabidopsis thaliana

Alignment Length:216 Identity:45/217 (21%)
Similarity:88/217 (41%) Gaps:53/217 (24%)


  Fly    87 QWIKTIVRPVNAFLIVDVQNDFI-SGSLDISNCSAQQQGHEILEPINKLLDTVDFDAVFYSLDWH 150
            :|..|      |.|::|:||||| .|::     :..:.|..|:..:.::::......:.  :.|.
plant     4 RWRNT------ALLVIDMQNDFIEEGAV-----TQVKGGKSIVPNVIRVVELARQRGIL--VIWV 55

  Fly   151 PSDHVSFIDNVKMRPMDESSALDSDSAKVFDTVIFAGPPPMKQRLWPRHCVQDSWGAELHKDLKV 215
            ..:|     :.:.|.::.....:..|.||       ||           .::.:.||||...|.:
plant    56 VREH-----DRQGRDVELFRRHNYSSEKV-------GP-----------VIKGTVGAELVDGLMI 97

  Fly   216 -VDHGIKVYKGTNPEVDSYSVFWDNKKLSDTTLNAQLKMKGATDIYVCGLAYDVCVGATAVDALS 279
             .:...|:.|      ..:|.|:      .|.|::.|:..|.|.:.:.|:....|:..|..||::
plant    98 NEEDDYKIVK------TRFSAFF------STNLHSFLQTSGVTKLVIAGVQTPNCIRQTVFDAVA 150

  Fly   280 AGYR--TILIDDCCRGT-DVH 297
            ..|.  |::.|.....| ::|
plant   151 LDYPNVTVITDATAAATPEIH 171

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NaamNP_001262738.1 EFh 20..81 CDD:238008
EF-hand_7 21..82 CDD:290234
nicotinamidase 97..315 CDD:238493 43/207 (21%)
AT3G16190NP_566539.1 cysteine_hydrolases 9..179 CDD:238245 43/206 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1076519at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
21.920

Return to query results.
Submit another query.