DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naam and AT3G16190

DIOPT Version :10

Sequence 1:NP_732446.1 Gene:Naam / 42348 FlyBaseID:FBgn0051216 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_566539.1 Gene:AT3G16190 / 820865 AraportID:AT3G16190 Length:196 Species:Arabidopsis thaliana


Alignment Length:216 Identity:45/216 - (20%)
Similarity:88/216 - (40%) Gaps:53/216 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 QWIKTIVRPVNAFLIVDVQNDFI-SGSLDISNCSAQQQGHEILEPINKLLDTVDFDAVFYSLDWH 150
            :|..|      |.|::|:||||| .|::     :..:.|..|:..:.::::......:.  :.|.
plant     4 RWRNT------ALLVIDMQNDFIEEGAV-----TQVKGGKSIVPNVIRVVELARQRGIL--VIWV 55

  Fly   151 PSDHVSFIDNVKMRPMDESSALDSDSAKVFDTVIFAGPPPMKQRLWPRHCVQDSWGAELHKDLKV 215
            ..:|     :.:.|.::.....:..|.||       ||           .::.:.||||...|.:
plant    56 VREH-----DRQGRDVELFRRHNYSSEKV-------GP-----------VIKGTVGAELVDGLMI 97

  Fly   216 -VDHGIKVYKGTNPEVDSYSVFWDNKKLSDTTLNAQLKMKGATDIYVCGLAYDVCVGATAVDALS 279
             .:...|:.|      ..:|.|:      .|.|::.|:..|.|.:.:.|:....|:..|..||::
plant    98 NEEDDYKIVK------TRFSAFF------STNLHSFLQTSGVTKLVIAGVQTPNCIRQTVFDAVA 150

  Fly   280 AGYR--TILIDDCCRGT-DVH 297
            ..|.  |::.|.....| ::|
plant   151 LDYPNVTVITDATAAATPEIH 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NaamNP_732446.1 FRQ1 <11..82 CDD:444056
nicotinamidase 97..315 CDD:238493 43/206 (21%)
AT3G16190NP_566539.1 PncA 9..184 CDD:440946 43/205 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.