DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naam and AT3G16190

DIOPT Version :9

Sequence 1:NP_001262738.1 Gene:Naam / 42348 FlyBaseID:FBgn0051216 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_566539.1 Gene:AT3G16190 / 820865 AraportID:AT3G16190 Length:196 Species:Arabidopsis thaliana


Alignment Length:216 Identity:45/216 - (20%)
Similarity:88/216 - (40%) Gaps:53/216 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 QWIKTIVRPVNAFLIVDVQNDFI-SGSLDISNCSAQQQGHEILEPINKLLDTVDFDAVFYSLDWH 150
            :|..|      |.|::|:||||| .|::     :..:.|..|:..:.::::......:.  :.|.
plant     4 RWRNT------ALLVIDMQNDFIEEGAV-----TQVKGGKSIVPNVIRVVELARQRGIL--VIWV 55

  Fly   151 PSDHVSFIDNVKMRPMDESSALDSDSAKVFDTVIFAGPPPMKQRLWPRHCVQDSWGAELHKDLKV 215
            ..:|     :.:.|.::.....:..|.||       ||           .::.:.||||...|.:
plant    56 VREH-----DRQGRDVELFRRHNYSSEKV-------GP-----------VIKGTVGAELVDGLMI 97

  Fly   216 -VDHGIKVYKGTNPEVDSYSVFWDNKKLSDTTLNAQLKMKGATDIYVCGLAYDVCVGATAVDALS 279
             .:...|:.|      ..:|.|:      .|.|::.|:..|.|.:.:.|:....|:..|..||::
plant    98 NEEDDYKIVK------TRFSAFF------STNLHSFLQTSGVTKLVIAGVQTPNCIRQTVFDAVA 150

  Fly   280 AGYR--TILIDDCCRGT-DVH 297
            ..|.  |::.|.....| ::|
plant   151 LDYPNVTVITDATAAATPEIH 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NaamNP_001262738.1 EFh 20..81 CDD:238008
EF-hand_7 21..82 CDD:290234
nicotinamidase 97..315 CDD:238493 43/206 (21%)
AT3G16190NP_566539.1 cysteine_hydrolases 9..179 CDD:238245 43/205 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1335
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1076519at2759
OrthoFinder 1 1.000 - - FOG0007602
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100439
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.