DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naam and ISOC2

DIOPT Version :10

Sequence 1:NP_732446.1 Gene:Naam / 42348 FlyBaseID:FBgn0051216 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_078986.1 Gene:ISOC2 / 79763 HGNCID:26278 Length:221 Species:Homo sapiens


Alignment Length:79 Identity:14/79 - (17%)
Similarity:29/79 - (36%) Gaps:23/79 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 IYVCGLAYDVCV----------------GATAVDALSAGYRTILIDDCCRGTDVHD-------IE 300
            :.:||:....|:                ..|.:|.|..|.:..::.|.|......|       :.
Human   104 VLLCGIEAQACILDPRSYPGLALTSLYPQNTTLDLLDRGLQVHVVVDACSSRSQVDRLVALARMR 168

  Fly   301 HTKEKVNTSDGVIV 314
            .:...::||:|:|:
Human   169 QSGAFLSTSEGLIL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NaamNP_732446.1 FRQ1 <11..82 CDD:444056
nicotinamidase 97..315 CDD:238493 14/79 (18%)
ISOC2NP_078986.1 YcaC_related 17..186 CDD:238494 14/79 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.