DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Naam and isoc1

Sequence 1:NP_001262738.1 Gene:Naam FlyBaseID:FBgn0051216 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_012821047.1 Gene:isoc1 XenbaseID:XB-GENE-491284 Length:319 Species:Xenopus tropicalis

Alignment Length:356 Identity:63/357 (18%)
Similarity:116/357 (32%) Gaps:122/357 (34%)


  Fly     2 DSPTPPIVIEDSNGSAMDACFTAFDKDSDDRLS---LAEFSIICR--------------ALFRND 49
            ::|.....:...:||..::|.:....:|.:..|   |..||:..|              ..|.:.
 Frog    12 ENPVCTAQVNIGSGSQSNSCISILGSNSINSNSVPVLFCFSVFARPSSVPHGSGYELLIQKFLSL 76

  Fly    50 KGHIYDVPPERLEQIFAVFDTNGDGFIDREEFKFCWNQWIKTIVRPVNAFLIVDVQNDFISGSLD 114
            .|...|:..:.:.|:||            ||    |.|:|                 |...|.:.
 Frog    77 YGDQIDMHRKFVVQLFA------------EE----WGQYI-----------------DLPKGFII 108

  Fly   115 ISNCSAQQQGHEILEPINKLLDTV----DFDAVFYSLDWHPSDHVSFIDNVKMRPMDESSALDSD 175
            ...|..:      |.|:...|.|:    ....||:..|...          :.||          
 Frog   109 SERCKIR------LVPLQIQLTTLGNLTPASTVFFCCDMQE----------RFRP---------- 147

  Fly   176 SAKVFDTVIFAGP-----------PPMKQRLWPRHCVQDSWGAELHK-DLKVVDHGIKV------ 222
            :.|.|..:|..|.           |.:....:|:     ..|:.:.: ||.    |:|:      
 Frog   148 AIKYFGDIISVGQRLLQGARILGIPVIATEQYPK-----GLGSTVQELDLT----GVKLVLPKTK 203

  Fly   223 YKGTNPEVDSYSVFWDNKKLSDTTLNAQLKMKGATDIYVCGLAYDVCVGATAVDALSAGYRTILI 287
            :....|||::        .|::|      ...|...:.:.|:...||:..||:|.:..|....::
 Frog   204 FSMVLPEVEA--------ALAET------PGVGVRSVVLFGVETHVCIQQTALDLIGRGVEVHIV 254

  Fly   288 DDCCRGTDVHDIEHTKEKVNTSDGVIVHTNQ 318
            .|......:.|.....|:: ..:|:|:.|::
 Frog   255 ADATSSRSMMDRMFALERL-ARNGIIITTSE 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NaamNP_001262738.1 EFh 20..81 CDD:238008 15/78 (19%)
EF-hand_7 21..82 CDD:290234 15/78 (19%)
nicotinamidase 97..315 CDD:238493 41/240 (17%)
isoc1XP_012821047.1 YcaC_related 135..291 CDD:238494 35/195 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1335
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.