DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Naam and Isoc1

Sequence 1:NP_001262738.1 Gene:Naam FlyBaseID:FBgn0051216 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_079754.2 Gene:Isoc1 MGIID:1913557 Length:297 Species:Mus musculus

Alignment Length:362 Identity:65/363 (18%)
Similarity:116/363 (32%) Gaps:132/363 (36%)


  Fly    13 SNGSAMDACFTAFDKDSDDRLSL---AEFSIICRALFRNDKGHIYDVPPERLEQIFAVFDTNGDG 74
            |.|..:..||:.|.:.:    |:   |.:.::.:. |.:..|...|:..:.:.|:||        
Mouse    22 SGGVPVLFCFSVFARPA----SVPHGAGYDVLIQK-FLSLYGDQLDMHRKFVVQLFA-------- 73

  Fly    75 FIDREEFKFCWNQWIKTIVRPVNAFLIVDVQNDFISGSLDISNCSAQQQGHEILEPINKLLDTVD 139
                ||    |.|::                 |...|......|..:      |.|:...|.|:.
Mouse    74 ----EE----WGQYV-----------------DLPKGFAVSERCKLR------LVPLQIQLTTLG 107

  Fly   140 F----DAVFYSLDWHPSDHVSFIDNVKMRPMDESSALDSDSAKVFDTVIFAGPPPMKQRLWPRH- 199
            .    ..||:..|...          :.||          :.|.|..:|..|     |||.... 
Mouse   108 NLTPPSTVFFCCDMQE----------RFRP----------AIKYFGDIISVG-----QRLLQGAR 147

  Fly   200 ------CVQDSWGAELHKDLKVVD-HGIKV------YKGTNPEVDSYSVFWDNKKLSDTTLNAQL 251
                  .:.:.:...|...::.:| .|:|:      :....|||::                |..
Mouse   148 ILGIPVIITEQYPKGLGSTVQEIDLTGVKLVLPKTKFSMVLPEVEA----------------ALA 196

  Fly   252 KMKGATDIYVCGLAYDVCVGATAVDALSAGYRTILIDDCCRGTDVHDIEHTKEK-------VNTS 309
            ::.|...:.:.|:...||:..||::.:..|....::.|......:.|.....|:       |.||
Mouse   197 EIPGVRSVVLFGVETHVCIQQTALELVGRGIEVHIVADATSSRSMMDRMFALERLARTGIIVTTS 261

  Fly   310 DGVIVH-------------TNQVKAMAEGRDRRPELG 333
            :.|::.             .|.:||.|      ||.|
Mouse   262 EAVLLQLVADKDHPKFKEIQNLIKASA------PESG 292

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NaamNP_001262738.1 EFh 20..81 CDD:238008 13/64 (20%)
EF-hand_7 21..82 CDD:290234 13/64 (20%)
nicotinamidase 97..315 CDD:238493 41/243 (17%)
Isoc1NP_079754.2 YcaC_related 115..269 CDD:238494 34/195 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1335
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.