DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Naam and isoc2

Sequence 1:NP_001262738.1 Gene:Naam FlyBaseID:FBgn0051216 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001073422.2 Gene:isoc2 ZFINID:ZDB-GENE-070518-1 Length:197 Species:Danio rerio

Alignment Length:168 Identity:33/169 (20%)
Similarity:65/169 (38%) Gaps:33/169 (20%)


  Fly   162 KMRP-MDESSALDSDSAKVFDTVIFAGPPPMKQRLWPRHC--VQDSWGAELHKDLKVVDHGIKVY 223
            |.|| :.:.:.:.|::|::.........|.:....:|:..  .....|||          |:|.:
Zfish    22 KFRPTIFQFTNVVSNAARLLQACRILNIPQILTEQYPKGLGPTVPELGAE----------GLKPH 76

  Fly   224 KGTNPEVDSYSVFWDNKKLSDTTLNAQLKMKG-ATDIYVCGLAYDVCVGATAVDALSAGYRTILI 287
            ..|     |:|:..:       ::.:.||..| ...:.:||:....|:..||.|.|..|....::
Zfish    77 TKT-----SFSMMTE-------SVQSSLKSMGDPQQVILCGIEAQACIACTAYDLLERGMEVHIV 129

  Fly   288 DDCCRGTDVHD-------IEHTKEKVNTSDGVIVHTNQ 318
            .|........|       :..:...:||::||::...|
Zfish   130 ADAVSSRSQTDRLFALSRLRQSGVFLNTTEGVLLQLVQ 167

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NaamNP_001262738.1 EFh 20..81 CDD:238008
EF-hand_7 21..82 CDD:290234
nicotinamidase 97..315 CDD:238493 32/164 (20%)
isoc2NP_001073422.2 YcaC_related 13..167 CDD:238494 32/167 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1335
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.