DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Naam and isoc2

Sequence 1:NP_001262738.1 Gene:Naam FlyBaseID:FBgn0051216 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_017950839.1 Gene:isoc2 XenbaseID:XB-GENE-946952 Length:229 Species:Xenopus tropicalis

Alignment Length:139 Identity:32/140 (23%)
Similarity:54/140 (39%) Gaps:30/140 (21%)


  Fly   219 GIKVYKGTN-----PEVDSYSVFWDNKKLSDTTLNAQLKMKGATD---IYVCGLAYDVCVGATAV 275
            |:|.|:.|:     ||::.                   |::...|   |.:||:....|:.:||:
 Frog    99 GLKKYEKTSFSMLTPEIEE-------------------KLQSIPDLRSIVLCGIETQACIMSTAL 144

  Fly   276 DALSAGYRTILIDDCCRGTDVHDIEHTKEKVNTSDGVIVHTNQVKAMAEGRDRRPELG--YKLAM 338
            |.|..||...::.|.|......|......::..|...:..:..|.....|..:.|:..  .|:.|
 Frog   145 DLLDKGYDVHVVADACSSRSQVDRLFALSRMRQSGAFLTTSEGVLLQLLGNAKHPKFKEVQKIIM 209

  Fly   339 ELKSPDSVL 347
            | .:|||.|
 Frog   210 E-PAPDSGL 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NaamNP_001262738.1 EFh 20..81 CDD:238008
EF-hand_7 21..82 CDD:290234
nicotinamidase 97..315 CDD:238493 22/104 (21%)
isoc2XP_017950839.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1335
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.