powered by:
Protein Alignment: Naam and CG11333
Sequence 1: | NP_001262738.1 |
Gene: | Naam |
FlyBaseID: | FBgn0051216 |
Length: | 357 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_651869.1 |
Gene: | CG11333 |
FlyBaseID: | FBgn0039850 |
Length: | 204 |
Species: | Drosophila melanogaster |
Alignment Length: | 75 |
Identity: | 22/76 (29%) |
Similarity: | 31/76 (41%) |
Gaps: | 15/76 (20%) |
Fly 254 KGATDIY--------VCGLAYDVCVGATAVDALSAGYRTILIDDCC-------RGTDVHDIEHTK 303
|..|||: :.||...|||..||.|.::......|:.||| |...:..:.|..
Fly 96 KSMTDIFGGKPKTVVLFGLETHVCVEQTAFDLVNDEIDVWLVADCCASRHNQDRDLALERLRHIG 160
Fly 304 EKVNTSDGVI 313
..:.||:.||
Fly 161 CNIATSESVI 170
|
Known Domains:
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
|
|
|
E1_COG1335 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.