DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naam and CG3663

DIOPT Version :10

Sequence 1:NP_732446.1 Gene:Naam / 42348 FlyBaseID:FBgn0051216 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_611952.1 Gene:CG3663 / 37944 FlyBaseID:FBgn0035044 Length:208 Species:Drosophila melanogaster


Alignment Length:98 Identity:24/98 - (24%)
Similarity:46/98 - (46%) Gaps:6/98 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 DIYVCGLAYDVCVGATAVDALSAGYRTILIDDCCRGTDVHDIEHTKEKVNTSDGVIVHTNQVKAM 322
            |:.:.||...:||..||:|.|.......::.|||......|.:...:::..: |.::.|::....
  Fly   104 DVVLYGLESHICVEQTAIDLLEQNINVYIVADCCSSRLNQDRDLALDRLRQA-GCVITTSESVIF 167

  Fly   323 AEGRDR-RPELGYKLAMELKSPDSVLSQ--RNG 352
            ...||: .|:  :.:..:|.:..||..:  |||
  Fly   168 DLVRDKNNPK--FDVVRKLVNQPSVDMELTRNG 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NaamNP_732446.1 FRQ1 <11..82 CDD:444056
nicotinamidase 97..315 CDD:238493 14/56 (25%)
CG3663NP_611952.1 YcaC_related 14..171 CDD:238494 15/67 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.