DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naam and CG3663

DIOPT Version :9

Sequence 1:NP_001262738.1 Gene:Naam / 42348 FlyBaseID:FBgn0051216 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_611952.1 Gene:CG3663 / 37944 FlyBaseID:FBgn0035044 Length:208 Species:Drosophila melanogaster


Alignment Length:98 Identity:24/98 - (24%)
Similarity:46/98 - (46%) Gaps:6/98 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 DIYVCGLAYDVCVGATAVDALSAGYRTILIDDCCRGTDVHDIEHTKEKVNTSDGVIVHTNQVKAM 322
            |:.:.||...:||..||:|.|.......::.|||......|.:...:::..: |.::.|::....
  Fly   104 DVVLYGLESHICVEQTAIDLLEQNINVYIVADCCSSRLNQDRDLALDRLRQA-GCVITTSESVIF 167

  Fly   323 AEGRDR-RPELGYKLAMELKSPDSVLSQ--RNG 352
            ...||: .|:  :.:..:|.:..||..:  |||
  Fly   168 DLVRDKNNPK--FDVVRKLVNQPSVDMELTRNG 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NaamNP_001262738.1 EFh 20..81 CDD:238008
EF-hand_7 21..82 CDD:290234
nicotinamidase 97..315 CDD:238493 14/56 (25%)
CG3663NP_611952.1 YcaC_related 14..171 CDD:238494 15/67 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1335
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.