DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Naam and pnc-2

Sequence 1:NP_001262738.1 Gene:Naam FlyBaseID:FBgn0051216 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001023531.1 Gene:pnc-2 WormBaseID:WBGene00013336 Length:316 Species:Caenorhabditis elegans

Alignment Length:290 Identity:88/291 (30%)
Similarity:148/291 (51%) Gaps:32/291 (11%)


  Fly    55 DVPPERLEQIFAVFDTNGDGFIDREEFKFCWNQ-----WIKTIVRPV----NAFLIVDVQNDFIS 110
            |:.|| |:::.       |.||:.:    .||:     :.:.:::|.    .:.|:||.||||::
 Worm    26 DLIPE-LDRLL-------DDFIENK----TWNEDTQELFTRVVLKPFTTLRTSLLVVDFQNDFVT 78

  Fly   111 GSLDISNCSAQQQGHEILEPINKLLDTVDFDAVFYSLDWHPSDHVSFIDNVK-----MRPMDESS 170
            |||.|....|:|...|.|..:|.||:.::::.:.|:.|||||:|:||.::.:     :.|.|:|.
 Worm    79 GSLSIKEGDAEQDPLEALPHVNNLLENLNWNMIVYTQDWHPSNHISFFEHARNPDRELAPEDKSR 143

  Fly   171 ALDSDSAKVFDTVIFAGPPPMKQRLWPRHCVQDSWGAELHKDLKVVDHGIKVYKGTNPEVDSYSV 235
            .|     :.||.|.|..|....|.|:|.||:|..||::||..|:.:|....:.||.:..||:||.
 Worm   144 KL-----RPFDIVRFVKPVSTIQVLYPSHCIQGGWGSQLHLGLQRIDGAHYIKKGADVYVDAYSA 203

  Fly   236 FWDNKKLSDTTLNAQLKMKGATDIYVCGLAYDVCVGATAVDALSAGYRTILIDDCCRGTDVHDIE 300
            |.||..:..:.|...|:......:..||||||:||..|..||...|:.|.::....:|.....::
 Worm   204 FSDNCGIKQSELEMLLRKNDINAVIGCGLAYDICVMHTLKDASKHGFLTCIVKSGSKGLSSLKMD 268

  Fly   301 HTKEKVNTSDGVIVHTNQVKAMAEGRDRRP 330
            .. .|:....||.:..:::..:...|:..|
 Worm   269 EA-NKMFQKRGVAIIDDEMAQLISRREAFP 297

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NaamNP_001262738.1 EFh 20..81 CDD:238008 7/26 (27%)
EF-hand_7 21..82 CDD:290234 7/27 (26%)
nicotinamidase 97..315 CDD:238493 76/223 (34%)
pnc-2NP_001023531.1 cysteine_hydrolases 64..282 CDD:294151 76/224 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124150869
eggNOG 1 0.900 E1_COG1335
Hieranoid 1 1.000
Homologene 1 1.000 H5938
Inparanoid 1 1.050 158 1.000 Inparanoid score I2861
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1076519at2759
OrthoFinder 1 1.000 FOG0010903
OrthoInspector 1 1.000 T374641
orthoMCL 1 0.900 OOG5_127752
Panther 1 1.100 O PTHR11080
Phylome 1 0.910 0.973 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R16483
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.