DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naam and pnc1

DIOPT Version :10

Sequence 1:NP_732446.1 Gene:Naam / 42348 FlyBaseID:FBgn0051216 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_596029.2 Gene:pnc1 / 2540906 PomBaseID:SPBC365.20C Length:220 Species:Schizosaccharomyces pombe


Alignment Length:232 Identity:71/232 - (30%)
Similarity:112/232 - (48%) Gaps:27/232 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 AFLIVDVQNDFISGSLDISNCSAQQQGHEILEPINKLLDT-VDFDAVFYSLDWHPSDHVSFIDNV 161
            |.:||||||||:....    .|:.:...|::..||:||:. ..:|.|..:.|.||.||:||..:.
pombe     6 ALIIVDVQNDFVHPVY----ISSGESALEVVPVINRLLENDYKWDTVIATKDVHPKDHLSFTTSH 66

  Fly   162 KMRPMDESSALDSDS-AKVFDTVIFAGPPPMKQRLWPRHCVQDSWGAELHKDLKVVDHGIKVYKG 225
            ...|....:.::.:: ..|:           ||.||..|||:::.|.|....|........:.||
pombe    67 SSTPKPSGTVVNIEAYGHVY-----------KQTLWNSHCVENTPGCEFPDSLNGDRIEFVIPKG 120

  Fly   226 TNPEVDSYSVFWDNKKLSDTTLNAQLKMKGATDIYVCGLAYDVCVGATAVDALSAGYRTILIDDC 290
            ::..|:|||.|:|... .|..|.|.|..||.||:::.|:|.|:||..||:.| ...|.|.:|.:.
pombe   121 SDRLVESYSGFYDAIG-RDNGLKAILDKKGITDVFIAGVATDICVKETALHA-RHWYNTYIISEA 183

  Fly   291 CRG--TDVH-----DIEHTK-EKVNTSDGVIVHTNQV 319
            .:|  |:.|     |....| |.::..|.::....:|
pombe   184 VKGSSTESHNQAIKDFRDAKIEVISEKDPILQSVRKV 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NaamNP_732446.1 FRQ1 <11..82 CDD:444056
nicotinamidase 97..315 CDD:238493 70/226 (31%)
pnc1NP_596029.2 cysteine_hydrolases 6..207 CDD:444760 69/217 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.