DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Naam and pnc-1

Sequence 1:NP_001262738.1 Gene:Naam FlyBaseID:FBgn0051216 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_499876.1 Gene:pnc-1 WormBaseID:WBGene00021395 Length:335 Species:Caenorhabditis elegans

Alignment Length:230 Identity:79/231 (34%)
Similarity:126/231 (55%) Gaps:4/231 (2%)


  Fly    98 AFLIVDVQNDFISGSLDISNCSAQQQGHEILEPINKLLDTVDFDAVFYSLDWHPSDHVSFIDNV- 161
            |.|:||.||||:.|||.|.:..|.|:....:.|:|:||....:|.|.|:.||||.:|:||:... 
 Worm    94 ALLVVDFQNDFVDGSLKIGDGDAGQEPSSAITPLNELLQLSSWDLVVYTKDWHPHNHISFLSQAH 158

  Fly   162 -KMRPMDESSALDSDSAKVFDTVIFAGPPPMKQRLWPRHCVQDSWGAELHKDLKVVDHGIKVYKG 225
             ..|.|||..  ::.:...||:|.|..|...:|.|:|.||:|.|||:::|.::.:.|:...:.||
 Worm   159 NSDRVMDEKD--ENKTLGFFDSVQFLKPIKTEQVLYPDHCIQKSWGSDIHPEIYIADNAEYIMKG 221

  Fly   226 TNPEVDSYSVFWDNKKLSDTTLNAQLKMKGATDIYVCGLAYDVCVGATAVDALSAGYRTILIDDC 290
            .:|.:||||.|.||...|.|.|...|:.:....:.:.|||||:||..|.:||:...:...:|.:|
 Worm   222 VDPYLDSYSAFNDNNGRSKTELEDLLRRENIDAVVIAGLAYDICVRFTCLDAVKQNFLAAVIPEC 286

  Fly   291 CRGTDVHDIEHTKEKVNTSDGVIVHTNQVKAMAEG 325
            ..|.....||.::.........::..::.:.:.||
 Worm   287 SAGLTKKGIEESEMAFKKQGVAMISKDEARGITEG 321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NaamNP_001262738.1 EFh 20..81 CDD:238008
EF-hand_7 21..82 CDD:290234
nicotinamidase 97..315 CDD:238493 77/219 (35%)
pnc-1NP_499876.1 nicotinamidase 92..310 CDD:238493 77/218 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124150873
eggNOG 1 0.900 E1_COG1335
Hieranoid 1 1.000
Homologene 1 1.000 H5938
Inparanoid 1 1.050 158 1.000 Inparanoid score I2861
Isobase 1 0.950 0 Normalized mean entropy S12195
OMA 1 1.010
OrthoDB 1 1.010 D1076519at2759
OrthoFinder 1 1.000 FOG0010903
OrthoInspector 1 1.000 T374641
orthoMCL 1 0.900 OOG5_127752
Panther 1 1.100 LDO PTHR11080
Phylome 1 0.910 0.974 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R16483
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.