DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nup58 and Nup98

DIOPT Version :9

Sequence 1:NP_650821.2 Gene:Nup58 / 42342 FlyBaseID:FBgn0038722 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_112336.2 Gene:Nup98 / 81738 RGDID:71033 Length:1816 Species:Rattus norvegicus


Alignment Length:450 Identity:118/450 - (26%)
Similarity:151/450 - (33%) Gaps:158/450 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TPTTNNAIGGATAATGAF---AFG-------------------------ARPATTTAPPPSFGAA 39
            |.|.....|..|.:.|||   |||                         ::|||:|:....||.:
  Rat    20 TSTFGQNTGFGTTSGGAFGTSAFGSSNNTGGLFGNSQTKPGGLFGTSSFSQPATSTSTGFGFGTS 84

  Fly    40 TSTPT--FGAAPATTSLFAAPAATPAFGAPAATPAFGAPASTPG-FGATSTAAPAFGTAAATPAF 101
            |.|..  ||.|...||||::.....|...|.....||...|:.| ||.|:|.:..||..:.: .|
  Rat    85 TGTSNSLFGTANTGTSLFSSQNNAFAQNKPTGFGNFGTSTSSGGLFGTTNTTSNPFGNTSGS-LF 148

  Fly   102 GIPAATSA-------FGAPAATPAF---------------------------------------- 119
            |..:.|:|       |..|..|...                                        
  Rat   149 GPSSFTAAPTGTTIKFNPPTGTDTMVKAGVSTNISTKHQCITAMKEYESKSLEELRLEDYQANRK 213

  Fly   120 ------GAAAATPAFG-APA---ATPAFGAPAATSAFGAPAATTAFGAPASTQASAFGA-PAPAV 173
                  ||...|..|| :||   ||..|.:....|||......||||    |..:.||. |....
  Rat   214 GPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSAFSYGQNKTAFG----TSTTGFGTNPGGLF 274

  Fly   174 G--TVAPTFSFATPATSAPTTAPPAFGFGTTATTAAAAMPASLSSGIGSFSFPKPQATTAASLNF 236
            |  ....|..|:.|...|.||....|.||.|:|   ...|::.:.|:    |...||:....| |
  Rat   275 GQQNQQTTSLFSKPFGQATTTPNTGFSFGNTST---LGQPSTNTMGL----FGVTQASQPGGL-F 331

  Fly   237 NTTTTTATAQPFNTGLKL-----------GTT----NATTTLG------------GGGIF-SKP- 272
            .|.|.|:|...|.||..|           |:|    |..||.|            .||:| :|| 
  Rat   332 GTATNTSTGTAFGTGTGLFGQPNTGFGAVGSTLFGNNKLTTFGTSTTSAPSFGTTSGGLFGNKPT 396

  Fly   273 ------------------AGQA---AAPAASTF-VGLG---GIDVTATQPKLGDNKQDGI 307
                              :|.:   :.|||.|. .|||   |..:.|.|..|..|.|..|
  Rat   397 LTLGTNTNTSNFGFGTNNSGSSIFGSKPAAGTLGTGLGTGFGTALGAGQASLFGNNQPKI 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nup58NP_650821.2 PHA03247 <25..195 CDD:223021 62/232 (27%)
Nucleoporin_FG2 136..>525 CDD:374260 64/228 (28%)
Nup98NP_112336.2 FG repeats 1 1..156 40/136 (29%)
Nucleoporin_FG 25..149 CDD:290362 35/124 (28%)
NupH_GANP 26..336 CDD:293373 83/322 (26%)
GLEBS, interaction with RAE1. /evidence=ECO:0000250 157..213 3/55 (5%)
FG repeats 2 214..480 73/254 (29%)
Nucleoporin_FG 215..303 CDD:290362 29/91 (32%)
Nucleoporin_FG 261..392 CDD:290362 39/138 (28%)
Nucleoporin2 740..880 CDD:282016
Nup96 1333..1624 CDD:288926
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.