DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nup58 and AgaP_AGAP007689

DIOPT Version :9

Sequence 1:NP_650821.2 Gene:Nup58 / 42342 FlyBaseID:FBgn0038722 Length:546 Species:Drosophila melanogaster
Sequence 2:XP_308182.4 Gene:AgaP_AGAP007689 / 1269540 VectorBaseID:AGAP007689 Length:429 Species:Anopheles gambiae


Alignment Length:389 Identity:74/389 - (19%)
Similarity:124/389 - (31%) Gaps:123/389 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 SLSSGIGSFSFPKPQATTAASLNFNTTTTTATAQPFNTGLKLGTTNATTTLGGGGIFSKPAGQAA 277
            :|..|.|...|...:|.:||....|       .:.|| |.||....|.......|:.  |.|..|
Mosquito    39 TLLRGFGFIQFHSEKAASAAIKAMN-------GKLFN-GRKLMVKVANDNRAKKGLL--PRGSTA 93

  Fly   278 APAASTFVGLGGIDVTATQPKLGDNKQDGIKIKETQVPDEI--IKTVDGLKAYIKQQKTIS---- 336
            |..|.                   :...|...::....|.|  ||     :.|..||.:::    
Mosquito    94 ASNAK-------------------SNASGAAARDRSPVDPIHPIK-----RGYHPQQYSVADLSS 134

  Fly   337 ----SDIGRTSTSKFTNVSHEITNLKWALQNMATLVEGSNQQIRLMRQETVKAIQSLEMAQRTQD 397
                :.||:.......:...||..:.   :.:....||...:::       :|..|:::.....|
Mosquito   135 VYPETPIGQAPHRGIESNDCEIIVVN---KELTPYAEGIEARLK-------RAGLSVDLLFPNND 189

  Fly   398 TPAGLQFENNAPFQYFQCLVAKYEQDLIAFRQQIALTERHMHAISNPQSISPDDLKRGFRQLN-- 460
            .|.|....|.|....:.|:|...|.     :::.::|...::.|.......|.|...||...|  
Mosquito   190 VPIGKVLANRASQGTYYCIVITPEN-----QERNSITVNVLYGIPAEHRNMPTDDAIGFIVKNFD 249

  Fly   461 ------------ESFISLA---------GRLH-EVHQRVEEHKE--------------------- 482
                        .::..:|         .:|| ::.||.|:|.|                     
Mosquito   250 DKRRQELAPHSRSAYHRVAPAVQPQPQPAQLHTDLEQRQEKHPEAIQNMINLLAANRSLTVLQYE 314

  Fly   483 ---HYLNLRR---YRLRDTTNVFERIDNPPLPTVEPQRISSGPTPFS---------NISALMNK 531
               .|||.|:   .||    .:.|.:|:....::.|..:|:.|....         .|..:|||
Mosquito   315 RLIKYLNERKETQIRL----ELGEDVDSTTASSLIPPIVSAAPVKSKQETERELQRKILDIMNK 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nup58NP_650821.2 PHA03247 <25..195 CDD:223021
Nucleoporin_FG2 136..>525 CDD:374260 70/381 (18%)
AgaP_AGAP007689XP_308182.4 RRM 10..74 CDD:214636 13/42 (31%)
HGTP_anticodon 153..247 CDD:281168 20/108 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.