DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6231 and CG4630

Sequence 1:NP_001262734.1 Gene:CG6231 FlyBaseID:FBgn0038720 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001260948.1 Gene:CG4630 FlyBaseID:FBgn0033809 Length:582 Species:Drosophila melanogaster

Alignment Length:591 Identity:154/592 (26%)
Similarity:252/592 (43%) Gaps:94/592 (16%)


  Fly     1 MDFDQILAKCGDFNRYQ---FMIL---ALFGFINIIVSMHY-FT---QTVISFVPDHWCYHDKLV 55
            :|||.||.:.|:|.|:|   ::::   .||...|   |:.| ||   .|...:||:  |  ||||
  Fly    13 LDFDDILVEIGEFGRFQRRNYLLICLPVLFAAAN---SLSYVFTAGSPTYRCYVPE--C--DKLV 70

  Fly    56 NMTYKEIGEIYAQFENP------------SCTR-------------------LDDINGHNVTVSS 89
            :..|   |..:.....|            :|.|                   ||.....|.|..:
  Fly    71 DAEY---GANWVSIAVPGSWSKRGHFTPSTCERFVANGDHLESSSDPWSAWPLDQCFAENFTTET 132

  Fly    90 KACEKWIYNYDFGYRSMNTELNWVC-DSAYKARIGQSLFFIGSVVGTLFYGLLSDKIGRVPALIL 153
            :.|.:::|.  ...|::..:....| ::.:|.....::.|.|.||||...|.|:|:.||....: 
  Fly   133 ERCNQFVYG--SSERTIVQQWGLQCPENLWKLAFVGTIHFAGLVVGTALSGYLADRYGRKHIFL- 194

  Fly   154 SNFC-------GFAGDFSTIFTKSVATFTLCRFISGLAADTNFYLMYIIVLEYIRPSMRTLGLNM 211
              ||       |.|...|..:    .:|.....::.:.....:.|.:||.:|.:.|..|.:. ::
  Fly   195 --FCIVFMALTGVAQALSWDY----ISFLFFALLNAVGTSGVYPLAFIIGVEMVGPRKREMS-SI 252

  Fly   212 AVGLFYCLGLVFTPWLAVLVGHWQIYLACTSLPILLVVLYYFVVQESAQWLVTRNDIDGAIVRLK 276
            .:..||.:|.... .|:|.:..|:......|:|.|:.|.|:::|.||.:||:.||..:.|.|.::
  Fly   253 VLNYFYAVGEALL-GLSVFLPDWRQLQLALSVPPLICVAYFWLVPESVRWLLARNRREQAGVIIR 316

  Fly   277 RVAKFNGCRVS---QADF--DEFRRHCQMTHEMLGG-----DDKKQATLLDMFRTPRMRKNTLIL 331
            |.||.|...:|   .|.|  .|.........::.||     |||....:.::.|:..:.....||
  Fly   317 RAAKVNRRDISVELMASFKQQELDAETGQEDDVEGGLHVKKDDKIWLAVKEVARSHILMGRYAIL 381

  Fly   332 FFKSMVITLCYDAVSRNVEGMGISPFIMFSLSALAVLPSSVLLVLLQDRIGRKGMASGSLLV--- 393
            .....|..:.|..:|.|...:..:.::.|:|..|..:|...|..|...|.||:...|||||:   
  Fly   382 LLIWAVNAIVYYGLSLNATSLSGNKYLNFALVCLVEIPGYSLAWLFLRRFGRRVALSGSLLLCSI 446

  Fly   394 ----GGLFTAAAGIAIAYQ-----QHNHNAI--LLACLTIAARFGVAISYESGSQYATELIPTCV 447
                .|..|.|.|..|..|     :|:.:..  |:..|.:..:.|:..|:.....:..|::||.:
  Fly   447 TCVASGFVTLAQGDWIPCQTGVESRHSWSCANWLVVTLFLVGKLGITSSFAVIYTFTAEMMPTVI 511

  Fly   448 RGQGVAAVHVAGFAASFLAPYILWLGTFFKAAPSIILGVLFFAGSFVCLLLPETLNRSLPTTIEE 512
            |..||..:.......:.|||::..|.:::...|.::.|.|......:.||||||.||.||.|:||
  Fly   512 RSGGVGVMSTFARFGAMLAPFVPLLASYYDPLPLLLFGTLSLVAGLLSLLLPETFNRKLPDTVEE 576

  Fly   513 GEVFGK 518
            ....||
  Fly   577 AIALGK 582

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6231NP_001262734.1 2A0119 11..509 CDD:273328 144/571 (25%)
MFS 125..499 CDD:119392 104/405 (26%)
CG4630NP_001260948.1 2A0119 23..573 CDD:273328 144/571 (25%)
MFS 158..533 CDD:119392 98/384 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55044442
eggNOG 1 0.900 E1_KOG0255
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I1712
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000018
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24064
RoundUp 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.