DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7342 and INT2

DIOPT Version :9

Sequence 1:NP_001247196.1 Gene:CG7342 / 42335 FlyBaseID:FBgn0038716 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_174313.1 Gene:INT2 / 839902 AraportID:AT1G30220 Length:580 Species:Arabidopsis thaliana


Alignment Length:320 Identity:69/320 - (21%)
Similarity:133/320 - (41%) Gaps:49/320 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 DAWKLTLGQSMFFVGSVVGSMVLGYLADVVGRLPILIVANLIAMTGNLLTIWSTNVTLFCMFRMI 167
            :.|...:..||...|::||:.:.|:..|.:||...:::|:.:.:.|.::...:.|.:|..:.|:.
plant    66 NTWLQEMIVSMAVAGAIVGAAIGGWANDKLGRRSAILMADFLFLLGAIIMAAAPNPSLLVVGRVF 130

  Fly   168 SGIATDSNFVMMYILVMEYMRPSVRTLGLSICIGFFYCLGSMAAPWIAVL-----MRSWRGFLLT 227
            .|:......:...:.:.|.....:|  |..:....|...|.....::..|     ..:||..|..
plant   131 VGLGVGMASMTAPLYISEASPAKIR--GALVSTNGFLITGGQFLSYLINLAFTDVTGTWRWMLGI 193

  Fly   228 TSLPLLVVPFFYLIVPESIQWLISKQKYDSAVVCLKRVAKING-----RHVEESAYAEFIEECKC 287
            ..:|.|:.......:|||.:||..|.:.:.|...|:|:.....     |.:::|...|.:||...
plant   194 AGIPALLQFVLMFTLPESPRWLYRKGREEEAKAILRRIYSAEDVEQEIRALKDSVETEILEEGSS 258

  Fly   288 SQQNQKASPHLLDLFQTPRLRRHTL----------------ILFFKSMVITLCYDAVSRNVQGLG 336
            .:.|      ::.|.:...:||..:                ::::...::.|...|.:|..    
plant   259 EKIN------MIKLCKAKTVRRGLIAGVGLQVFQQFVGINTVMYYSPTIVQLAGFASNRTA---- 313

  Fly   337 ISPFVMFSLSATAILPACLLIIALQ--DRIGRKAMASASLLLSGIFIS--VTGGIIFAAS 392
                ::.|| .||.|.|...||::.  ||||||.:...||.  |:.||  :..|:.:.|:
plant   314 ----LLLSL-VTAGLNAFGSIISIYFIDRIGRKKLLIISLF--GVIISLGILTGVFYEAA 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7342NP_001247196.1 2A0119 12..491 CDD:273328 69/320 (22%)
MFS 93..>243 CDD:119392 27/144 (19%)
INT2NP_174313.1 SP 25..552 CDD:273317 69/320 (22%)
MFS 33..541 CDD:119392 69/320 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.