DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7342 and Slc22a27

DIOPT Version :10

Sequence 1:NP_650815.2 Gene:CG7342 / 42335 FlyBaseID:FBgn0038716 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_017173565.1 Gene:Slc22a27 / 171405 MGIID:3042283 Length:576 Species:Mus musculus


Alignment Length:36 Identity:10/36 - (27%)
Similarity:16/36 - (44%) Gaps:3/36 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SMG---QIAPDSQIDAMIKEASGPINFTVFLTLFGE 87
            |:|   |....:.:|..|.:||..:..:...|.|.|
Mouse   158 SLGLNLQFCDSNIVDHFICDASPLLKISCSDTWFME 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7342NP_650815.2 2A0119 12..491 CDD:273328 10/36 (28%)
Slc22a27XP_017173565.1 MFS_OAT 134..540 CDD:340932 10/36 (28%)

Return to query results.
Submit another query.