DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5316 and HNT3

DIOPT Version :9

Sequence 1:NP_650805.1 Gene:CG5316 / 42322 FlyBaseID:FBgn0038704 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_014901.1 Gene:HNT3 / 854432 SGDID:S000005784 Length:217 Species:Saccharomyces cerevisiae


Alignment Length:229 Identity:65/229 - (28%)
Similarity:94/229 - (41%) Gaps:79/229 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSWSSALIKDISKPENL------IISSEIAVVIADKFPKAQHHYLVLPLADIPSIFHLNRSHLS- 58
            |||..||...::.||.:      ....::: :|.|.|||::.|.|:|     |....|:|||.: 
Yeast     1 MSWRYALKNYVTSPETVNDDTVTYFDDKVS-IIRDSFPKSECHLLIL-----PRTMQLSRSHPTK 59

  Fly    59 --------------------------------------------LLEELHLLARNVVEVKGVRWQ 79
                                                        :|::.:...||.|:       
Yeast    60 VIDAKFKNEFESYVNSAIDHIFRHFQEKFRIKKSDDDKDPCWDDILKDKNKFVRNFVQ------- 117

  Fly    80 DFNVGFHAEPSMQRLHLHVISKDFVSTSLKTKKHWNSFNTELFVPYTKLYAQLEKENSISRLPKS 144
               ||.|:.|||..||:|||||||.|..||.|||:|||||..|:.:..|  .|..:|  ....|.
Yeast   118 ---VGIHSVPSMANLHIHVISKDFHSVRLKNKKHYNSFNTGFFISWDDL--PLNGKN--LGTDKE 175

  Fly   145 LKDELLAK-PLICNQCEFVARNLPS----LKGHL 173
            ::...|.: .|:|..|:   ||..:    ||.||
Yeast   176 IETTYLKEHDLLCCYCQ---RNFSNKFSLLKKHL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5316NP_650805.1 DcpS_C 8..100 CDD:288796 29/142 (20%)
zf-C2HE 119..179 CDD:292895 16/60 (27%)
DcpS_C 235..326 CDD:288796
zf-C2HE 345..405 CDD:292895
HNT3NP_014901.1 HIT 15..139 CDD:395984 32/139 (23%)
zf-C2HE 153..212 CDD:406643 17/61 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345731
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 1 Normalized mean entropy S3909
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003607
OrthoInspector 1 1.000 - - oto99583
orthoMCL 1 0.900 - - OOG6_103324
Panther 1 1.100 - - LDO PTHR12486
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R76
SonicParanoid 1 1.000 - - X4024
TreeFam 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.