DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5316 and HNT3

Sequence 1:NP_650805.1 Gene:CG5316 FlyBaseID:FBgn0038704 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_014901.1 Gene:HNT3 SGDID:S000005784 Length:217 Species:Saccharomyces cerevisiae

Alignment Length:229 Identity:65/230 (28%)
Similarity:94/230 (41%) Gaps:79/230 (34%)


  Fly     1 MSWSSALIKDISKPENL------IISSEIAVVIADKFPKAQHHYLVLPLADIPSIFHLNRSHLS- 58
            |||..||...::.||.:      ....::: :|.|.|||::.|.|:|     |....|:|||.: 
Yeast     1 MSWRYALKNYVTSPETVNDDTVTYFDDKVS-IIRDSFPKSECHLLIL-----PRTMQLSRSHPTK 59

  Fly    59 --------------------------------------------LLEELHLLARNVVEVKGVRWQ 79
                                                        :|::.:...||.|:       
Yeast    60 VIDAKFKNEFESYVNSAIDHIFRHFQEKFRIKKSDDDKDPCWDDILKDKNKFVRNFVQ------- 117

  Fly    80 DFNVGFHAEPSMQRLHLHVISKDFVSTSLKTKKHWNSFNTELFVPYTKLYAQLEKENSISRLPKS 144
               ||.|:.|||..||:|||||||.|..||.|||:|||||..|:.:..|  .|..:|  ....|.
Yeast   118 ---VGIHSVPSMANLHIHVISKDFHSVRLKNKKHYNSFNTGFFISWDDL--PLNGKN--LGTDKE 175

  Fly   145 LKDELLAK-PLICNQCEFVARNLPS----LKGHL 173
            ::...|.: .|:|..|:   ||..:    ||.||
Yeast   176 IETTYLKEHDLLCCYCQ---RNFSNKFSLLKKHL 206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5316NP_650805.1 DcpS_C 8..100 CDD:288796 30/143 (21%)
zf-C2HE 119..179 CDD:292895 16/61 (26%)
DcpS_C 235..326 CDD:288796
zf-C2HE 345..405 CDD:292895
HNT3NP_014901.1 HIT_like 15..139 CDD:320837 33/140 (24%)
zf-C2HE 153..212 CDD:318507 17/62 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C198591762
eggNOG 1 0.900 E1_KOG0562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 1 Normalized mean entropy S3909
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005179
OrthoInspector 1 1.000 T1136022
orthoMCL 1 0.900 OOG5_129343
Panther 1 1.100 LDO PTHR12486
Phylome 1 0.910 0.958 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R76
TreeFam 00.000 Not matched by this tool.
98.720

Return to query results.
Submit another query.