DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5316 and APTX

Sequence 1:NP_650805.1 Gene:CG5316 FlyBaseID:FBgn0038704 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_195751.2 Gene:APTX AraportID:AT5G01310 Length:710 Species:Arabidopsis thaliana

Alignment Length:204 Identity:77/205 (38%)
Similarity:111/205 (54%) Gaps:28/205 (14%)


  Fly     2 SWSSALIKDISKP---ENLIIS-SEIAVVIADKFPKAQHHYLVLPLAD-IPSIFHLNRSHLSLLE 61
            :|:.||......|   ||:::. .:..|||.|::|||:.|.|||...: :..:..:.:.:|.||:
plant   513 TWALALHSIAMHPERHENVVLEYLDNIVVINDQYPKARKHVLVLARQESLDGLEDVRKENLQLLQ 577

  Fly    62 ELHLLARNVVEVKGVRWQD----------FNVGFHAEPSMQRLHLHVISKDFVSTSLKTKKHWNS 116
            |:|    ||    |::|.|          |.:|:|:.|||::|||||||:||.|.|||.||||||
plant   578 EMH----NV----GLKWVDRFQNEDASLIFRLGYHSVPSMRQLHLHVISQDFNSDSLKNKKHWNS 634

  Fly   117 FNTELFVPYTKLYAQLEKENSISRLPKSLKDELLAKPLICNQCEFVARNLPSLKGHLVG-HLQDP 180
            |.|..|.....:   ||:.||..:...:.:| ||...|.||:|.....|:|.||.|:.. |.|.|
plant   635 FTTSFFRDSVDV---LEEVNSQGKANVASED-LLKGELRCNRCRSAHPNIPKLKSHVRSCHSQFP 695

  Fly   181 KSVCQRVRL 189
            ..:.|..||
plant   696 DHLLQNNRL 704

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5316NP_650805.1 DcpS_C 8..100 CDD:288796 36/107 (34%)
zf-C2HE 119..179 CDD:292895 20/61 (33%)
DcpS_C 235..326 CDD:288796
zf-C2HE 345..405 CDD:292895
APTXNP_195751.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T192541
orthoMCL 1 0.900 OOG5_129343
Panther 1 1.100 LDO PTHR12486
Phylome 1 0.910 0.714 Consistency score
43.910

Return to query results.
Submit another query.