DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5316 and Aptx

Sequence 1:NP_650805.1 Gene:CG5316 FlyBaseID:FBgn0038704 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_079821.3 Gene:Aptx MGIID:1913658 Length:342 Species:Mus musculus

Alignment Length:178 Identity:72/179 (40%)
Similarity:104/179 (58%) Gaps:9/179 (5%)


  Fly     3 WSSALIKDISKPENLIISSEIAVVIADKFPKAQHHYLVLPLADIPSIFHLNRSHLSLLEELHLLA 67
            ||..|...:..|:..:...:..|||.||:|||:||:||||.|.|.|:..:...||.||:.:|.:.
Mouse   167 WSQGLKMSMKDPKMQVYKDDQVVVIKDKYPKARHHWLVLPWASISSLKVVTSEHLELLKHMHAVG 231

  Fly    68 RNVV-EVKGVRWQDFNVGFHAEPSMQRLHLHVISKDFVSTSLKTKKHWNSFNTELFVPYTKLYAQ 131
            ..|: :..|.....|.:|:||.|||..:||||||:||.|..||.||||||||||.|:....:...
Mouse   232 EKVIADFAGSSKLRFRLGYHAIPSMSHVHLHVISQDFDSPCLKNKKHWNSFNTEYFLESQAVIKM 296

  Fly   132 LEKENSISRLPKSLKD---ELLAKPLICNQCEFVARNLPSLKGHLVGH 176
            :::...:     ::||   |||..||.|::|:.:..::|.||.||..|
Mouse   297 VQEAGRV-----TVKDGTCELLKLPLRCHECQQLLPSIPQLKEHLRKH 339

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5316NP_650805.1 DcpS_C 8..100 CDD:288796 37/93 (40%)
zf-C2HE 119..179 CDD:292895 18/62 (29%)
DcpS_C 235..326 CDD:288796
zf-C2HE 345..405 CDD:292895
AptxNP_079821.3 Interactions with ADPRT and NCL. {ECO:0000250} 1..102
FHA 12..105 CDD:238017
Nuclear localization signal. {ECO:0000250} 118..122
aprataxin_related 164..265 CDD:238609 40/98 (41%)
Interaction with DNA substrate. {ECO:0000250|UniProtKB:Q7Z2E3} 193..197 3/4 (75%)
Interaction with DNA substrate. {ECO:0000250|UniProtKB:Q7Z2E3} 255..256 1/1 (100%)
Histidine triad motif. {ECO:0000255|PROSITE-ProRule:PRU00464} 258..262 2/4 (50%)
zf-C2HE 284..340 CDD:292895 18/62 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C198584060
eggNOG 1 0.900 E1_KOG0562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 1 Normalized mean entropy S3909
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005179
OrthoInspector 1 1.000 T1083386
orthoMCL 1 0.900 OOG5_129343
Panther 1 1.100 LDO PTHR12486
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R76
TreeFam 00.000 Not matched by this tool.
98.720

Return to query results.
Submit another query.