DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5316 and APTX

Sequence 1:NP_650805.1 Gene:CG5316 FlyBaseID:FBgn0038704 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_016870320.1 Gene:APTX HGNCID:15984 Length:423 Species:Homo sapiens

Alignment Length:95 Identity:36/96 (38%)
Similarity:53/96 (55%) Gaps:1/96 (1%)


  Fly     3 WSSALIKDISKPENLIISSEIAVVIADKFPKAQHHYLVLPLADIPSIFHLNRSHLSLLEELHLLA 67
            ||..|...:..|:..:...|..|||.||:|||::|:||||...|.|:..:.|.||.||:.:|.:.
Human   181 WSQGLKISMQDPKMQVYKDEQVVVIKDKYPKARYHWLVLPWTSISSLKAVAREHLELLKHMHTVG 245

  Fly    68 RNV-VEVKGVRWQDFNVGFHAEPSMQRLHL 96
            ..| |:..|.....|.:|:||.|||..:.:
Human   246 EKVIVDFAGSSKLRFRLGYHAIPSMSSIRV 275

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5316NP_650805.1 DcpS_C 8..100 CDD:288796 33/91 (36%)
zf-C2HE 119..179 CDD:292895
DcpS_C 235..326 CDD:288796
zf-C2HE 345..405 CDD:292895
APTXXP_016870320.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C198585608
eggNOG 1 0.900 E1_KOG0562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 1 Normalized mean entropy S3909
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005179
OrthoInspector 1 1.000 T1073302
orthoMCL 1 0.900 OOG5_129343
Panther 1 1.100 LDO PTHR12486
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R76
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.720

Return to query results.
Submit another query.